SecReT6
Protein ID: 186893992
SecReT6 ID277
T6SS typei3
Gene symbol-
Locus tagYPTS_0663
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]740987..741973 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB2K494
KEGG IDypb:YPTS_0663
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-08, Aligned region: 45..102
ImpA-rel_N [PF06812], Evalue: 3.10E-08, Aligned region: 174..194
Protein Sequence: 328 a.a.     [Download]
>gi|186893992|ref|YP_001871104.1| ImpA domain-containing protein [Yersinia pseudotuberculosis PB1/+]
MSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKLLEQCFDLRVMLWFI
RANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKTARLTEEHPY
ILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESYQLHC
EQLRIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDRILEYFQHY
EPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
 
Nucleotide Sequence: 987 bp     [Download]
>gi|186893344|ref|NC_010634.1|:740987-741973 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAGTGACATATTTCCTCAAGCATTATTCGGCGTTGAATATGATCCGGCCTATGGCGAGATTGAGTCCA
TCCTCTCTCAATTAGATGAGTCTGCGGACCCCCTTTCCCGCCCGCATGAACCCCCTCAAATAAACTGGCA
CCATATCAGTGAGCAAGCCAATAAGCTGCTAGAACAATGTTTTGATTTACGTGTAATGCTTTGGTTTATA
AGGGCAAATATTCATATAAAAGGAATCTCGGCCCTCTATGATGGCTTTATGCGCATTAATGCACAAACCC
AAGATACTGATGTTGTTATCTACCCTCAATCGGAAGAACCGCCATTAAATAGTGGGCATGCCGCCGCATT
AGGTTGGTTATCTACAGCACAATGTATTGCAGAGCTTAAGACTGCACGCCTTACAGAAGAGCACCCTTAC
ATTTTACAAGATCTTATTACGACTGAAGCGTTACCCAATGGCCAAGAGAGATATTTTGTTACATCTTCGA
CATTATTTTTAACTGTCAATAATTATTTCCAACAGAATGGATTGCCAGATTTAAAAGACCAATTGACAAA
AGTAGATATGTTGTTGGAACAAATTGAGTCCTATGCAAATCAATCCACAGAGAGTTACCAACTGCATTGT
GAACAATTACGTATTTTCTTAAAAAATAATATTTCTCAGCTTGCACAATTGAATGCCCCAGAACATGACG
ATCCCGAAACTGTTTATCAAAAAATAGACAGTCATGAATCTCTTGATACTCAGTCCTTTAATTCAAATGA
TAAGAGCATTCGCTCACGGCAAGAGATCATTATGATGCTGGACCGTATTCTAGAGTACTTTCAACATTAT
GAGCCTAGTCATCCAGCCCCAATATTCATTCGCCGTACCAAAGAGATGATAGGTATGGATTTTTATTCCA
TTGTTGAAGAAATTCTGCCTGAAGCTGTAATTACATTAAAACAGTTTACCGGAAAAACTAACCTACCGTT
TCGATGA