SecReT6
Protein ID: 186893999
SecReT6 ID277
T6SS typei3
Gene symbol-
Locus tagYPTS_0670
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]748124..750712 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB2K4A1
KEGG IDypb:YPTS_0670
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.90E-33, Aligned region: 225..247
AAA_2 [PF07724], Evalue: 3.90E-33, Aligned region: 595..762
AAA [PF00004], Evalue: 3.40E-20, Aligned region: 226..359
AAA [PF00004], Evalue: 3.40E-20, Aligned region: 601..729
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 26..94
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 203..248
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 269..305
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 414..480
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 574..645
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 666..693
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 747..822
AAA_5 [PF07728], Evalue: 2.40E-10, Aligned region: 226..246
AAA_5 [PF07728], Evalue: 2.40E-10, Aligned region: 448..497
AAA_5 [PF07728], Evalue: 2.40E-10, Aligned region: 600..706
Clp_N [PF02861], Evalue: 2.70E-09, Aligned region: 22..73
Clp_N [PF02861], Evalue: 2.70E-09, Aligned region: 111..122
AAA_22 [PF13401], Evalue: 4.60E-08, Aligned region: 225..339
AAA_22 [PF13401], Evalue: 4.60E-08, Aligned region: 364..388
AAA_22 [PF13401], Evalue: 4.60E-08, Aligned region: 598..627
Sigma54_activat [PF00158], Evalue: 9.00E-08, Aligned region: 205..245
Sigma54_activat [PF00158], Evalue: 9.00E-08, Aligned region: 587..706
Zeta_toxin [PF06414], Evalue: 6.40E-07, Aligned region: 168..201
Zeta_toxin [PF06414], Evalue: 6.40E-07, Aligned region: 226..249
Zeta_toxin [PF06414], Evalue: 6.40E-07, Aligned region: 590..640
NACHT [PF05729], Evalue: 3.30E-06, Aligned region: 226..253
NACHT [PF05729], Evalue: 3.30E-06, Aligned region: 601..728
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 223..247
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 598..622
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 813..826
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 226..265
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 600..636
ClpB_D2-small [PF10431], Evalue: 3.70E-05, Aligned region: 455..480
ClpB_D2-small [PF10431], Evalue: 3.70E-05, Aligned region: 767..841
ResIII [PF04851], Evalue: 7.30E-05, Aligned region: 184..248
ResIII [PF04851], Evalue: 7.30E-05, Aligned region: 293..308
ResIII [PF04851], Evalue: 7.30E-05, Aligned region: 572..621
T2SE [PF00437], Evalue: 8.90E-05, Aligned region: 212..248
T2SE [PF00437], Evalue: 8.90E-05, Aligned region: 375..404
T2SE [PF00437], Evalue: 8.90E-05, Aligned region: 597..630
Arch_ATPase [PF01637], Evalue: 9.90E-05, Aligned region: 205..246
Arch_ATPase [PF01637], Evalue: 9.90E-05, Aligned region: 278..375
Arch_ATPase [PF01637], Evalue: 9.90E-05, Aligned region: 598..628
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 226..250
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 601..626
Torsin [PF06309], Evalue: 0.00094, Aligned region: 558..623
DUF87 [PF01935], Evalue: 0.0021, Aligned region: 228..248
DUF87 [PF01935], Evalue: 0.0021, Aligned region: 434..468
DUF87 [PF01935], Evalue: 0.0021, Aligned region: 602..629
AAA_25 [PF13481], Evalue: 0.0025, Aligned region: 209..250
AAA_25 [PF13481], Evalue: 0.0025, Aligned region: 356..388
AAA_25 [PF13481], Evalue: 0.0025, Aligned region: 599..613
AAA_29 [PF13555], Evalue: 0.0027, Aligned region: 218..244
AAA_29 [PF13555], Evalue: 0.0027, Aligned region: 598..632
IstB_IS21 [PF01695], Evalue: 0.0027, Aligned region: 215..249
IstB_IS21 [PF01695], Evalue: 0.0027, Aligned region: 600..617
AAA_30 [PF13604], Evalue: 0.0027, Aligned region: 218..248
AAA_30 [PF13604], Evalue: 0.0027, Aligned region: 599..623
RNA_helicase [PF00910], Evalue: 0.0034, Aligned region: 227..247
RNA_helicase [PF00910], Evalue: 0.0034, Aligned region: 601..622
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 220..301
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 600..637
DEAD [PF00270], Evalue: 0.0055, Aligned region: 212..381
DEAD [PF00270], Evalue: 0.0055, Aligned region: 598..623
FtsK_SpoIIIE [PF01580], Evalue: 0.0084, Aligned region: 224..252
FtsK_SpoIIIE [PF01580], Evalue: 0.0084, Aligned region: 599..621
DUF2075 [PF09848], Evalue: 0.0086, Aligned region: 228..328
DUF2075 [PF09848], Evalue: 0.0086, Aligned region: 599..621
DUF258 [PF03193], Evalue: 0.0089, Aligned region: 220..246
DUF258 [PF03193], Evalue: 0.0089, Aligned region: 599..620
Protein Sequence: 862 a.a.     [Download]
>gi|186893999|ref|YP_001871111.1| type VI secretion ATPase [Yersinia pseudotuberculosis PB1/+]
MYQRERLFNRLGTFAYKTFVEATRLCRSYRHEYVELEHWLKILMDQQRGDIPALLTHYGLSQTVISTQLD
RIIQHMPVTKASVQDLSSRLESVVEGGLVLSQLMASPSPIRTSHILLALLQDTQHQRWLYRLCDEFKKLP
VPQVAEEYEGLLVNSIEQTSEVQRGDALVTETDSSSSKEAHAALNKWCNDLTQQARDGEIDPVIGREAEL
RQVIDILLRRRQNNPILVGEAGVGKTAVVEALARKLASGDVPPLLQGARLLSLDLGRMQAGASMRGEFES
RLKSLIDGISQSDTPVILFCDEAHTLVGAGGQAGTGDAVNLLKPMLARGALRMIAATTWSEYKQFIEPDA
ALTRRFQRVLIGEPNESTAVDMLRAIAPHFAQHHNVTIRDGAIHAAVRLSLRNLPSRQLPDKAISLLDTA
CARVALSQYAQPQAIEQLSAQLDVLKTEHQYLVREKQLGEAVDQRLDDVQTQIQAFEYELTALQSRHLHE
QQLVREVLPEGEGSGMMTENARWGELMALQEASPLVYPWVDEQSIAAVLSDWTGIPSGKMLQDDIECVLN
LEQRLGDHIFGQRNAIKEISQAIRIARAGIQSQERPLGIFLLAGSTGTGKTETANVLVETLYGGAHNLIT
FNMSEFQEAHTLSTLKGAPPGYVGYGKGGKLTEAVRRKPYSVILLDEFDKAHADIQDAFYQVFDKGWMED
AEGRRVSFRQCFILLTCNQGAEEIEQAYLTANDIKPGALKPLVYDALLRRFAPALLARVNIIPYIPLDQD
ALAQIASHHLARLQTRLWDEIGATLVTEGDIPGWIASRVCSHPNHGRAVEELLRQTLLPAVGNEVLKRRH
EAEPLREIRLIVEETELSIEFA
 
Nucleotide Sequence: 2589 bp     [Download]
>gi|186893344|ref|NC_010634.1|:748124-750712 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
GTGTATCAACGCGAACGTCTTTTTAATCGATTGGGCACTTTTGCCTATAAAACTTTTGTTGAAGCCACCC
GTCTTTGCCGCAGTTATCGGCATGAGTATGTGGAGCTTGAACATTGGTTAAAAATTCTCATGGATCAACA
GCGTGGGGACATTCCTGCTCTACTGACGCATTACGGACTGAGCCAAACGGTTATCTCCACGCAATTGGAT
CGCATTATTCAGCATATGCCCGTCACCAAAGCATCGGTGCAGGATTTATCATCACGCTTGGAGTCCGTGG
TCGAAGGCGGATTGGTGTTGAGCCAATTGATGGCGTCACCTTCTCCTATCCGTACCTCACATATTTTACT
GGCACTATTACAGGATACCCAGCATCAGCGCTGGTTATACCGCCTGTGCGATGAATTCAAAAAGCTGCCG
GTCCCACAGGTTGCAGAGGAATATGAAGGCCTATTAGTTAACTCCATTGAACAGACCAGCGAGGTTCAAA
GAGGCGACGCATTAGTGACGGAAACGGACAGCAGCTCATCAAAAGAAGCGCATGCGGCATTGAACAAATG
GTGTAACGACCTTACCCAGCAAGCCCGTGACGGTGAGATTGACCCCGTTATTGGTCGTGAAGCAGAACTG
CGTCAAGTGATTGATATTTTACTCCGTCGCCGTCAGAACAACCCTATTTTGGTTGGGGAAGCGGGGGTCG
GTAAAACGGCGGTGGTTGAAGCGCTAGCGCGAAAACTGGCCAGTGGCGATGTCCCTCCGCTGTTGCAAGG
GGCGCGTCTGCTTTCTCTGGATTTGGGGAGGATGCAAGCCGGTGCCAGTATGCGCGGTGAATTTGAATCA
CGTCTTAAATCCCTGATCGATGGCATCAGCCAATCGGATACCCCGGTTATTCTGTTTTGTGATGAAGCCC
ATACGTTGGTGGGGGCAGGCGGGCAGGCGGGCACGGGGGATGCGGTCAACCTGCTTAAACCGATGTTGGC
GAGGGGCGCATTGCGCATGATCGCCGCCACCACCTGGTCAGAGTATAAACAGTTTATTGAACCTGACGCC
GCGCTGACCCGGCGTTTCCAGCGGGTATTGATTGGCGAGCCAAACGAATCTACCGCCGTCGATATGCTAC
GGGCGATTGCGCCACATTTTGCTCAACATCATAACGTCACTATCCGCGACGGTGCCATTCACGCGGCGGT
GCGCCTGTCATTACGCAACCTGCCTTCCCGGCAGTTGCCCGATAAAGCCATCAGTCTGCTCGACACCGCT
TGCGCGCGGGTCGCGCTCAGCCAATATGCCCAACCACAGGCGATTGAACAGTTATCGGCCCAACTGGATG
TGCTTAAAACCGAGCATCAATATCTGGTACGGGAGAAGCAACTGGGCGAAGCGGTTGATCAACGGCTAGA
TGACGTTCAGACACAGATCCAAGCGTTTGAATATGAACTAACCGCCTTGCAAAGCCGCCATCTGCATGAG
CAACAGCTAGTGAGGGAGGTCCTGCCGGAGGGAGAAGGCAGTGGCATGATGACGGAAAATGCCCGCTGGG
GTGAACTGATGGCGTTACAGGAAGCGTCGCCACTGGTCTATCCATGGGTTGATGAGCAGAGCATCGCCGC
GGTGCTTTCCGATTGGACCGGGATCCCGTCCGGCAAAATGTTGCAGGACGATATTGAATGCGTCCTGAAT
CTTGAACAGCGTCTCGGTGATCATATTTTCGGGCAACGCAACGCTATCAAAGAGATTTCGCAGGCGATAC
GTATTGCTCGGGCGGGCATCCAGTCTCAGGAGCGGCCACTCGGGATCTTCCTGCTGGCGGGGTCAACCGG
TACGGGCAAAACAGAAACGGCCAATGTACTGGTCGAAACCTTGTATGGCGGTGCTCATAACCTTATTACC
TTCAATATGAGTGAGTTCCAAGAGGCGCATACCTTATCCACGCTGAAAGGCGCACCTCCGGGCTATGTCG
GCTATGGCAAGGGGGGGAAATTAACCGAAGCGGTAAGACGCAAACCTTATTCGGTCATCCTGCTTGATGA
GTTTGATAAAGCTCACGCCGATATTCAGGACGCCTTTTATCAGGTCTTCGACAAAGGGTGGATGGAAGAT
GCCGAAGGGCGTCGGGTCAGTTTCCGCCAGTGTTTCATCTTACTGACCTGTAATCAGGGCGCGGAAGAGA
TCGAACAGGCTTACCTCACCGCCAACGATATCAAACCCGGTGCATTAAAACCGTTGGTATACGACGCCCT
GTTGCGCCGCTTTGCGCCAGCGCTGTTAGCCAGGGTCAATATCATTCCTTATATCCCATTAGATCAGGAC
GCTCTGGCACAGATCGCCTCTCATCATCTTGCGCGCTTACAAACGCGCCTGTGGGATGAAATTGGTGCCA
CTTTGGTGACCGAGGGGGATATCCCCGGCTGGATCGCCTCACGGGTTTGCAGCCATCCGAACCATGGTCG
TGCGGTGGAAGAACTCTTGCGTCAAACCTTACTTCCCGCTGTTGGCAATGAAGTGTTGAAGCGTCGCCAT
GAGGCTGAACCGCTGAGAGAGATACGCCTGATTGTTGAGGAGACAGAACTGAGTATTGAGTTCGCGTAG