SecReT6
Protein ID: 186894007
SecReT6 ID277
T6SS typei3
Gene symbol-
Locus tagYPTS_0678
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]759462..761072 [+]
Producthypothetical protein
NoteTssL
UniProt IDB2K4A9
KEGG IDypb:YPTS_0678
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-43, Aligned region: 143..338
OmpA [PF00691], Evalue: 1.20E-12, Aligned region: 398..501
Protein Sequence: 536 a.a.     [Download]
>gi|186894007|ref|YP_001871119.1| hypothetical protein YPTS_0678 [Yersinia pseudotuberculosis PB1/+]
MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEDLADQAASGN
NMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAW
DNAYIAAAMPLLLLVENIRSWPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFN
GLQTPDSYNQSLLVEFHRDAWGGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLM
DLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNIL
TWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFINKKNIERLGL
ALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAIGRGESDPLAD
NATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|186893344|ref|NC_010634.1|:759462-761072 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAACGAATTTGAACGCCAGATCCGTGCAGCCATTTCCGCAGCACGCAATGGCGCAAAACATGCGGAAC
AGTCACTGACTACACCAATGTGGCAAGCCAAAAGCACCGTAGCCTCATTGGGTGGGATTGTCCCTAGAAG
TGGCTCTTCGTCAACGTCACAGGCGGAGAACTATAAGGAAGATCTCGCGGACCAGGCTGCCTCGGGCAAC
AACATGGCGCGCACGAGTGCGCCACCGGTCACTTTGTATCAGCAACAGCCAAATGCGAATGACAGCTATC
CAAACGGGAATAACAACAATCCAAACGGGGATAACAACAATCCAAACGGGAGTAACAACAATATAGCGAG
AGTACAGCGTATGCCGCATGGCATTTCCAGGGGCTTATATGAGCGCCCTGGGATGTTATTGGGTGCCTGG
GATAACGCCTATATTGCTGCGGCTATGCCTTTGCTGCTGCTGGTGGAAAATATTCGTAGCTGGCCGACGC
GTAACGCCGCAGAGGTCAGGCCACCGATTGTGCGGGAATTACAATATTTCCAGCAACATTTGCAGAAAAA
GAACTACCCGCAAGAAGACATTAACCACCTGTCTTACCTGCTATGTACCTATATCGATGGCATTTTTAAC
GGGCTGCAAACCCCAGACTCCTACAACCAAAGTCTGTTAGTGGAGTTTCACCGTGATGCCTGGGGGGGTG
AGGACTGCTTCGAACATCTGCGGGTCTATATGAACTCGCCGAAACAGTACCGGGAAGTTCTGGAATTCTA
TGATCTGATTATGTGCCTTGGTTTTGACGGTAAATACCAGATGATAGAGCATGGTGCGGTTCTGCTGATG
GATTTACGCAGCCGTCTCCACACGCAACTCTACGGTCAGGACGCCACACAATCTTTGGCTATCGCGCAAG
CGGTCAAAGGTTCTCCGCGTCGCCAATATATCAAGGCGCTGAAAATCTTCACCTATGGTTTCGCACTGTG
CCTTTGTGCTTACGGCGTCACGGCGTGGTATCTGCACCAGCAATCCCAACAGATCCGCAGCAACATTCTG
ACGTGGGTACTGCCTGAACCGCGGAAAATCAACATCATGGAGACCTTGCCGAATCCGCTATCCAACATCC
TGAATGAAGGGTGGCTGGAGGTCAGGAAAGATCCGCGTGGATGGCTATTAATCTTCACCTCCGACGGCGC
GTTCCGCACGGGTGAAGCGACCCTCTCGGAAGAGTTTATCAACAAGAAGAATATCGAACGTCTTGGGCTG
GCATTAGCCCCATGGCCGGGAGATATCGAGGTTATTGGTCATACGGATAACAAACCGTTCCGTAGCACTT
CCGGTAACAACAACCTCAAACTTTCCGCGGCCAGAGCATCGGTGGTGGCAGATAAACTGCGGGAATCCAC
TCAAATCAACGAAACCCATCAGCGAGAAATAAGTGCCATCGGACGGGGGGAGAGCGATCCTTTAGCTGAC
AATGCAACGGAAGAAGGGCGCAAGCGTAACCGGCGTGTGGATATCCTATGGAAAATTGGTCAGCGCGATG
CCGATAAGGCCATGAAGCAATTCCTGGAGAACCCAACACCAGAAGTTCAAGGAACGAATACCCAACAATA
G