SecReT6
Protein ID: 186894904
SecReT6 ID278
T6SS typei2
Gene symbol-
Locus tagYPTS_1590
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]1776014..1776514 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB2JYW2
KEGG IDypb:YPTS_1590
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.40E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|186894904|ref|YP_001872016.1| type VI secretion protein [Yersinia pseudotuberculosis PB1/+]
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|186893344|ref|NC_010634.1|:1776014-1776514 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGTGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAACAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCTCCC
TGACCTTCAACGACATGAAAGATTTCGAGCCAGAAAACGTGGCCCGTCAAATTCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTTAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCGCCAA
AAGAGGGTTAA