SecReT6
Protein ID: 186894906
SecReT6 ID278
T6SS typei2
Gene symbol-
Locus tagYPTS_1592
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]1778119..1779471 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB2JYW4
KEGG IDypb:YPTS_1592
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-133, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|186894906|ref|YP_001872018.1| type VI secretion protein [Yersinia pseudotuberculosis PB1/+]
MKIERPLWARGILVSPQQFQQQASWEAWTNECIAQMAVMHPWGVLQATFELDALAQGRLKAARLHVRFQD
GVLVDTECADVLPPTLTLAASLPAEASDATVMLAIPQLYANGGNCLQPDERGERPVRHRQAWRDVQNQFG
DDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQ
LRARLQRLMGMRRESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLT
FSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLRDPRLREGADF
YLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
TQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|186893344|ref|NC_010634.1|:1778119-1779471 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAAAATTGAACGCCCTCTGTGGGCTCGCGGGATCCTGGTGTCTCCGCAACAATTTCAACAACAGGCTT
CCTGGGAGGCCTGGACCAATGAATGCATTGCGCAAATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGC
CACTTTTGAATTGGATGCATTGGCACAGGGCCGCCTGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGAC
GGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCTGCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCG
CCGAGGCCAGCGACGCCACGGTGATGCTGGCGATACCACAACTGTATGCCAATGGCGGTAACTGCCTGCA
GCCGGATGAGCGGGGCGAACGCCCGGTACGCCATCGTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGC
GATGACAAAAAGCAGGTCGCGGTGATGTACCACCAACTGACCCTGCGGCTGGACACTCAGGAAAACGGCG
ATTATCAGGTCTGCCCGGTGGCGCGTTTGCTGCGGGATGCGCAAGGTCGCTGGACACTGGATCCGGGCTT
TATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCTGGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAA
CTGCGGGCGCGTTTGCAGCGTCTGATGGGGATGCGCCGGGAGAGCAATGCACGGATGGCCGATTTTGCTG
TCGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCCCTTAACAGTGCCGAACCGGTATTGGGGAATTTTCA
GCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATCAGGAACTGGCCAGGCTGGCGGGCAGCCTGCTGACG
TTCTCCCTTGAACACGAAGTGACGGCGATCCCGGTTTATCAGCATGAACAGCTGACCCGCGTCTTTCCCC
CGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCCAGCCTCCCATCACGGGTGGTGGCGATTGAGCTGGT
TCATGAACCGCGCATCAATCAGTGGCGCGCGACCCTGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTC
TACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCAATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCG
GTGCGCCGGATGAGGTCGGTAACGTGGTGAATGTTGCGCTGAGTGGCATCCCACTGCGTCCGCTCAGCCA
TGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACCAGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCG
ACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTATGTACCCGGTACGCTGGGTGAGATCCAACTGGAGC
TGTTTGCGGTGCTACGCGCATGA