SecReT6
Protein ID: 186894907
SecReT6 ID278
T6SS typei2
Gene symbol-
Locus tagYPTS_1593
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]1779468..1780154 [+]
Producthypothetical protein
NoteTssL
UniProt IDB2JYW5
KEGG IDypb:YPTS_1593
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-47, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|186894907|ref|YP_001872019.1| hypothetical protein YPTS_1593 [Yersinia pseudotuberculosis PB1/+]
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSGGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLTTLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|186893344|ref|NC_010634.1|:1779468-1780154 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGCCCTGTTACAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAAACTGTGAAAGGGCGCGGTGTACAGGATGATGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGTAGCCAGCTTTACGAGCG
GATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGATCGCGCGGTACTGACCTGTTTTCACCGGGTATTAATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCCGGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGCTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTCGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTGTCCGGTCTGTTAACCACCTTACTGCCGGAGCCGGTGTAA