SecReT6
Protein ID: 186894911
SecReT6 ID278
T6SS typei2
Gene symbol-
Locus tagYPTS_1597
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]1785427..1787925 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB2JYW9
KEGG IDypb:YPTS_1597
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.80E-65, Aligned region: 34..354
DUF2345 [PF10106], Evalue: 6.50E-48, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 3.60E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 3.60E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 3.90E-15, Aligned region: 390..481
Protein Sequence: 832 a.a.     [Download]
>gi|186894911|ref|YP_001872023.1| ImpA family type VI secretion-associated protein [Yersinia pseudotuberculosis PB1/+]
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMQDASLTLAA
PVAEAFGVTVQQTQRVIHGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYPP
GLTLQAVPPSGMHDSGVESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFSGVANAATLGPSQELKVTGNDVPAQFGKGVIIIRI
TSYARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWEPGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGVLRAEKGLFITAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGAITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKAKQVVAMPEFQL
IPGGKHNLQFLFTDDDNVPYSNTPYIAYLVDGREIKGVTDAKGNTEKFVTDEEQNIKINLQV
 
Nucleotide Sequence: 2499 bp     [Download]
>gi|186893344|ref|NC_010634.1|:1785427-1787925 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAATACCACTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCCACTATGCTGATGCAGGACGCGTCACTGACATTGGCGGCC
CCGGTGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCACGGGGTGGTGACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAACGTTTTTACCCGCCA
GGGCTGACGCTACAAGCGGTGCCACCTTCGGGGATGCACGACAGCGGCGTGGAGTCGGTCTGGGACTTAT
CCAGTGCTCATCAGGTGGTTGAAAAATCTGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
TATGACCGCCGGGGCCGACATCACGCGCGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGACCGCAGGCAGTGAAGGGCGCGAGCCGGAAAGTGAAAGCGGGGCCTTTTATGCCCGCCTGC
GCCATGAACGTTACCTGAACAATCAGGCGCGCTTTTCGGGGGTAGCCAATGCGGCGACACTGGGGCCGAG
TCAGGAACTGAAAGTCACCGGAAACGATGTGCCGGCACAGTTTGGTAAAGGGGTGATAATCATCCGCATC
ACCAGCTATGCCCGCCGTGACCGCAGCTATGAAGTGCATTTTGAGGCTATCCCTTACTCCGAAGATTATT
GCTTCCGTCCAGCACTTATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCGAACGACACCTATGGTCATATCGACAAAGACGGGCGTTACCGTGTCAATCTGATGTTCGACCGTGAC
AGTTGGGAGCCGGGTTACGAAAGCCTTTGGGTTCGTCAGGCCCGCCCGTATGCGGGTGACACCTACGGCC
TGCACCTGCCACTGCTGGCGGGCACCGAAGTGGCGATTGCGTTTGAGGATGGCAACCCGGACCGGCCCTA
TATTGCTTATGTGTTGCACGACTCGGCGCACGGCGACCATGTCACCATCAGTAATTACAAACGCAACGTA
CTTCGCACTCCGTCGAATAACAAACTGCGCCTTGAGGATGAACGGGGTAAAGAGCACATCAAGCTCAGCA
CCGAATATGGCGGCAAAAGCCAACTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGTATTACGGGCAGAAAAAGGCCTCTTTATCACTGCCGAC
GGACAGGCCAAAGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCAACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGCAGTGGCGAACATTTACAACTGTCGGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATG
CGGATGTCAGTGTAGGTAAGAATTTTTTTATCGGTGTGGGCAACACGCTGAGCGTATTTGTACGCAAGCT
GGGGATAAAGTTGATAGCGAATCAGGGAGCAATAACGGTACAGGCCCAGAATGATCTGATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATAACGC
TAAATGCAGGCGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGACAGGAAAAAGCGAAGCAGGTAGTGGCAATGCCAGAATTTCAGCTG
ATTCCCGGTGGGAAGCATAATCTACAATTTCTATTTACCGATGATGATAATGTACCTTATTCAAATACAC
CGTATATTGCTTATCTTGTCGATGGAAGAGAAATTAAAGGAGTGACAGATGCAAAAGGTAATACGGAAAA
ATTTGTTACCGATGAAGAGCAAAATATAAAAATAAATTTACAGGTATAG