SecReT6
Protein ID: 186894914
SecReT6 ID278
T6SS typei2
Gene symbol-
Locus tagYPTS_1600
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]1790029..1792731 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB2JYX2
KEGG IDypb:YPTS_1600
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-64, Aligned region: 34..354
DUF2345 [PF10106], Evalue: 5.70E-49, Aligned region: 610..757
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 589..618
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 4.10E-15, Aligned region: 390..481
Protein Sequence: 900 a.a.     [Download]
>gi|186894914|ref|YP_001872026.1| ImpA family type VI secretion-associated protein [Yersinia pseudotuberculosis PB1/+]
MNTSLPAIRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMQDASLTLAA
PVAEAFGVTVQQTQRVIHGVVTGFKRLSASKDECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFISRLLADVGLWFRFTADPKLNIDVVEFYDDQRFYPP
GLTLQAVPPSGMHDSGVESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLIAGSEEREPESESGAFYARLRHERYLNNQARFSGVANAATLGPSQELKVTGNDVPAQFGKGVIIIRI
TSYARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWEPGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGLFISAD
GQAKAQGQVLEMQPAISLLQGAQEQMDAISADAQTATASPADLQAQISLLQQNLSELKQAVVLLSAPKGI
ALSSGEHLQMSASENLIATAGKNTDISVAKNLFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELL
ARKAITITSTENEIKITAKKRITLNAGGSYITLDENRIESGTAGEYITKAGHYERQEKASLKSIIPAFPI
IEPGEHSLRFAFYGDDNVIGSMGHLVGQPYNIRNSAGEVIASGVLDQSGRFPRVKTQEADELTLTLGEEK
WTVEELIASTEDPIGEEFSEPDEYDVDSDPYFENIAQEQQSNRLPDTIINKFIGYVEEDI
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|186893344|ref|NC_010634.1|:1790029-1792731 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAATACCTCTCTCCCCGCTATTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCCACGATGCTGATGCAGGACGCGTCACTGACATTGGCGGCC
CCGGTGGCCGAAGCCTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCACGGCGTGGTGACCGGAT
TTAAACGCCTGTCTGCTTCAAAAGATGAATGCCGTTACGAACTGAGCCTGCAACCGCGTTTGGCTTTGTT
GTCGCGTAGCCATCAGAACGGGATTTATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCCCGCCGTGAGCAGG
TGATGCAGTACGGCGAAGATGACCTGACCTTTATCAGCCGCCTGCTGGCGGATGTGGGGCTCTGGTTTCG
TTTTACCGCTGACCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAACGTTTTTACCCGCCA
GGGCTGACGCTACAAGCGGTGCCACCTTCGGGGATGCACGACAGCGGCGTGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCTGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGCGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGATCGCAGGCAGCGAAGAGCGTGAGCCGGAAAGTGAAAGTGGGGCGTTTTATGCCCGCCTGC
GCCATGAACGTTACCTGAACAATCAGGCGCGCTTTTCGGGGGTAGCCAATGCGGCGACACTGGGGCCGAG
TCAGGAACTGAAAGTCACCGGAAACGATGTGCCGGCACAGTTTGGTAAAGGGGTGATAATCATCCGCATC
ACCAGCTATGCCCGCCGTGACCGCAGCTATGAAGTGCATTTTGAGGCTATCCCTTACTCCGAAGATTATT
GCTTCCGTCCAGCACTTATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCGAACGACACCTATGGTCATATCGACAAAGACGGGCGTTACCGTGTCAATCTGATGTTCGACCGTGAC
AGTTGGGAGCCGGGTTACGAAAGCCTTTGGGTTCGTCAGGCCCGCCCGTATGCGGGTGACACCTACGGCC
TGCACCTGCCACTGCTGGCGGGCACCGAAGTGGCGATTGCGTTTGAGGATGGCAACCCGGACCGGCCCTA
TATTGCTTATGTGTTGCACGACTCGGCGCACGGCGACCATGTCACCATCAGTAATTACAAACGCAACGTA
CTTCGCACTCCGTCGAATAACAAACTGCGCCTTGAAGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCACGGGGTGA
AGGTTTTGAGCTGCGTACCGACAGTTTTGGTGCATTGCGTGCAGAAAAGGGCCTCTTTATCAGTGCCGAC
GGTCAGGCCAAAGCCCAGGGGCAGGTGCTGGAGATGCAACCGGCTATTAGCCTGTTGCAAGGTGCTCAGG
AACAGATGGATGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTGCAGGCACAAAT
CAGTTTGTTGCAGCAAAATCTGAGTGAGCTGAAACAAGCCGTGGTATTGCTGAGTGCGCCAAAAGGCATT
GCCTTGAGCAGTGGTGAGCATCTGCAAATGTCCGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATA
CCGACATCAGCGTAGCAAAGAACTTATTTATTGGTGTGGGAAATACCTTAAGTATCTTCGTCAGAAAACT
GGGGATGAAGCTGATAGCCAATCAGGGGCCGATAACAGTCCAGGCGCAGAATGATCTGATGGAGTTATTG
GCGCGCAAGGCGATAACGATCACCAGTACCGAGAATGAGATAAAAATCACCGCCAAGAAGAGGATTACGC
TGAATGCGGGCGGCAGTTATATCACGCTGGATGAGAATCGGATTGAGTCAGGCACGGCTGGTGAATATAT
AACCAAAGCAGGGCATTACGAGCGGCAGGAAAAGGCGAGTTTAAAATCTATAATACCTGCTTTTCCTATT
ATTGAACCGGGAGAACATAGTTTACGGTTTGCATTCTATGGTGACGATAATGTTATTGGGTCTATGGGAC
ATCTTGTCGGGCAGCCTTACAATATCCGTAATAGCGCTGGTGAAGTTATAGCTTCAGGAGTATTGGATCA
ATCTGGCCGTTTCCCAAGAGTAAAAACTCAAGAAGCGGATGAGTTAACGCTGACTTTAGGTGAGGAAAAA
TGGACAGTAGAAGAGCTTATAGCGTCAACAGAAGATCCTATCGGTGAGGAGTTTAGCGAACCTGATGAAT
ACGATGTAGATAGTGATCCTTATTTCGAAAATATCGCTCAAGAACAACAAAGTAATAGATTGCCTGATAC
AATAATTAATAAATTTATTGGCTATGTAGAAGAGGATATCTAG