SecReT6
Protein ID: 186894927
SecReT6 ID278
T6SS typei2
Gene symbol-
Locus tagYPTS_1613
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]1807635..1808087 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB2JYY5
KEGG IDypb:YPTS_1613
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-14, Aligned region: 31..116
Protein Sequence: 150 a.a.     [Download]
>gi|186894927|ref|YP_001872039.1| type VI secretion system lysozyme-like protein [Yersinia pseudotuberculosis PB1/+]
MPDSSSPSLYEQLLGNFTGGLDLHQVSDENQVILSVLDNMQRILNCRAGTLSHLPDYGLPDMSKILQGLP
GSAHSLLTTLSATLLKYEPRLKSLQVILLPQTTPGHLEYAIDAELKGLGLVRYGTAFMPEGRVLMRHLKQ
QHYLNQRESF
 
Nucleotide Sequence: 453 bp     [Download]
>gi|186893344|ref|NC_010634.1|:1807635-1808087 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGCCGGATTCCTCCTCGCCGTCACTGTATGAGCAATTGCTGGGCAATTTCACCGGCGGGCTTGACCTGC
ATCAGGTCAGTGACGAAAACCAGGTCATTCTCTCGGTGCTGGACAATATGCAACGCATTCTTAATTGTCG
GGCCGGAACACTCAGTCATCTGCCCGATTATGGCCTGCCGGACATGAGTAAAATTCTGCAGGGGTTGCCG
GGCAGCGCGCATTCGCTGCTGACCACGCTGTCCGCCACCTTGCTGAAATACGAGCCGCGTCTGAAAAGTT
TGCAGGTGATTCTGTTGCCACAGACCACACCCGGTCATCTGGAATACGCCATTGATGCGGAGCTGAAAGG
GCTGGGACTGGTGCGCTATGGCACGGCGTTTATGCCGGAGGGCAGGGTGTTGATGCGCCACCTTAAACAA
CAACACTACCTCAATCAGCGGGAGTCATTTTGA