SecReT6
Protein ID: 186894928
SecReT6 ID278
T6SS typei2
Gene symbol-
Locus tagYPTS_1614
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]1808111..1809478 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB2JYY6
KEGG IDypb:YPTS_1614
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.60E-49, Aligned region: 116..150
DUF3702 [PF12486], Evalue: 2.60E-49, Aligned region: 303..448
ImpA-rel_N [PF06812], Evalue: 2.20E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 2.20E-20, Aligned region: 231..244
Protein Sequence: 455 a.a.     [Download]
>gi|186894928|ref|YP_001872040.1| ImpA domain-containing protein [Yersinia pseudotuberculosis PB1/+]
MISNIERTLKTGGDPRALADFTTLRGELNKLAHPARPDVDWARVEQLCLALFRQNGVELQTAVDFTLART
HTVGLAGLCEGLELLAGLVCHQWSGLWPPQTHVRVALLAWLSDRLQQVWRTMTLCYGDLAQVYRAERALE
QLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGLAEPSVTSEPPESLRFASVPVSEPLVYIISE
PAPPPVQVVLPASPPRWKAGHGFAAGLSLMAVLMAGSFVIWQSVSSDPVRETLLATASPLPTPLSANSIA
ELKKQASDVEWARLAEPVLQASATQLDQLAQLPPLWAQTHGDAWLAQTQQLWPASQEVKRLSTLWQQQRE
AGAAPLVELKHYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|186893344|ref|NC_010634.1|:1808111-1809478 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGATATCGAATATTGAACGCACACTGAAAACCGGTGGCGACCCGCGTGCACTGGCGGATTTCACCACAC
TGCGGGGTGAATTAAATAAACTGGCCCACCCGGCCCGTCCGGATGTTGACTGGGCGCGGGTTGAGCAACT
GTGTCTGGCGCTATTTCGCCAGAACGGCGTTGAGTTACAGACTGCCGTTGATTTTACCCTGGCACGAACG
CACACCGTTGGGTTGGCGGGCTTATGTGAAGGGCTGGAACTGTTGGCGGGGTTGGTCTGCCATCAATGGA
GTGGGTTATGGCCACCGCAAACGCATGTCCGGGTGGCGTTACTGGCCTGGCTGAGTGACCGGCTGCAACA
AGTGTGGCGCACCATGACGTTATGCTACGGTGACCTGGCGCAGGTGTACCGGGCAGAGCGGGCGCTGGAA
CAGTTGTGTACGCAGTTGCAAACGCTGGAGCTCAAACATTTGTGCAAGCTGGACGGGGTTCGTTTGATGC
TGCATAACGCGGCGCAGCGGTTGGAAAGTACCGAGGCCGTGTCTGGCCTTGCGGAACCATCGGTTACCTC
TGAACCGCCCGAGTCGCTGCGATTTGCCTCTGTCCCGGTCAGTGAACCACTGGTGTATATTATCAGCGAA
CCGGCCCCGCCACCTGTTCAGGTGGTTTTACCTGCCTCACCTCCGCGCTGGAAGGCGGGCCACGGTTTTG
CCGCGGGGTTATCGTTGATGGCGGTGCTGATGGCCGGCAGTTTCGTTATCTGGCAGTCGGTATCATCGGA
TCCCGTGAGGGAAACATTGCTGGCCACTGCCAGTCCTTTGCCGACACCGCTGAGTGCTAACTCAATAGCT
GAACTGAAAAAACAGGCTTCAGATGTTGAGTGGGCACGTCTGGCGGAACCGGTGTTGCAAGCCAGTGCGA
CGCAGTTAGATCAACTGGCACAGTTACCGCCGTTATGGGCGCAGACTCATGGAGATGCATGGTTAGCTCA
GACACAACAACTGTGGCCCGCGAGTCAAGAGGTCAAACGGTTGAGCACTTTGTGGCAGCAACAGCGAGAA
GCCGGTGCTGCGCCCTTGGTAGAGTTGAAACACTATGCATTGGCGCAAGACCGTTTGCGGCAACTGGCAG
AACGACTGAATAGTCTGGATGAGAAAAAACGCGGATATATGACGGTCTCCGAACTGAAATCTGCCGTCTT
TGCTATCCAACAGCCGCTGGCACAGGCCGTGCCACTGGAAGAACTGCTGCGGCAATATCAGGAACAATTA
GAATCAGGGCAAACTCCATCCTCAGCACTGCGTCAACAGATTGACAGCCGGTTTAGTCAATTGCTGAACC
GCTATGCGTTGCTGGTCGTACCTCCTGGCGTTCAGTAA