SecReT6
Protein ID: 186896058
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2753
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3051568..3052374 [-]
Productvirulence protein SciE type
NoteTagJ
UniProt IDB2K8L5
KEGG IDypb:YPTS_2753
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.30E-45, Aligned region: 145..263
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 47..76
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 105..136
Protein Sequence: 268 a.a.     [Download]
>gi|186896058|ref|YP_001873170.1| virulence protein SciE type [Yersinia pseudotuberculosis PB1/+]
MNTTNLTELLKSASLTEMLADVIATIKAKPTDTDTRELLFKLYCIDGSWQKALLQLETLTQLLPEFTKQA
ELYKNLILSEKMRDEVLAGKRSPGTLGNDLPEWVALLQQANQLHHDGDHQQSEALREQALQQAPESIGES
ATTGCFAWIADSDGRMGPVCEFISAGGYRWVPFAEIQSLTVSKPKNITDLIWAPAQVKVKDKVWYGYIPA
RYPLTPETDNETKLGLKTEWHQPTDSLYIGAGRKMFITDQGEHALFDIEEIVFEIDCV
 
Nucleotide Sequence: 807 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c3052374-3051568 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAATACCACGAATTTAACTGAGTTATTAAAAAGCGCGTCTTTAACCGAAATGCTGGCCGATGTCATTG
CTACGATAAAAGCTAAGCCAACGGATACCGATACGCGAGAACTGTTATTCAAACTCTATTGTATTGATGG
TTCATGGCAAAAAGCCCTATTGCAGCTTGAAACATTGACACAGCTTTTACCTGAGTTCACCAAACAGGCT
GAACTCTATAAAAATCTGATATTGAGTGAGAAAATGCGTGATGAAGTGCTGGCAGGCAAACGCAGCCCTG
GTACGTTGGGTAACGACCTGCCTGAATGGGTAGCCTTGTTGCAACAAGCTAATCAACTCCACCATGATGG
CGATCATCAGCAAAGTGAGGCCCTCCGTGAACAGGCTCTGCAACAGGCACCGGAAAGTATCGGAGAGAGC
GCTACGACAGGCTGCTTCGCTTGGATTGCTGACAGTGATGGGCGTATGGGGCCTGTTTGTGAGTTTATTA
GCGCCGGCGGTTACCGTTGGGTCCCGTTTGCAGAGATACAATCACTCACTGTTTCCAAACCTAAAAATAT
TACAGACCTGATATGGGCGCCGGCACAGGTTAAAGTAAAGGATAAAGTTTGGTACGGTTATATACCTGCC
CGCTATCCACTGACACCTGAAACAGACAATGAAACTAAACTGGGTCTTAAAACAGAATGGCATCAACCGA
CTGACTCACTTTATATTGGGGCAGGGCGGAAAATGTTTATCACCGACCAAGGTGAGCATGCGCTGTTTGA
TATTGAAGAGATTGTATTTGAGATAGATTGTGTTTGA