SecReT6
Protein ID: 186896060
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2755
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3053242..3053502 [-]
Producthypothetical protein
NotePAAR
UniProt IDB2K8L7
KEGG IDypb:YPTS_2755
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 6..78
PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 73..86
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 16..36
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 38..70
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 75..85
Protein Sequence: 86 a.a.     [Download]
>gi|186896060|ref|YP_001873172.1| hypothetical protein YPTS_2755 [Yersinia pseudotuberculosis PB1/+]
MFSAAKMGDVTSDGGAICTGSCDVFINNIPASKLGSGATSTLVGLTALVTGSGTVFINNCPATRCSDKTG
CGSVIVTGSPNVFIGN
 
Nucleotide Sequence: 261 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c3053502-3053242 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGTTCAGTGCGGCAAAAATGGGCGATGTGACCAGCGATGGTGGTGCGATATGTACCGGTTCATGCGATG
TGTTCATTAACAATATTCCGGCCTCTAAGCTGGGTTCGGGCGCAACGTCTACGTTGGTAGGCCTGACGGC
GCTGGTAACTGGCTCTGGAACGGTATTTATCAATAATTGTCCCGCGACGCGTTGTAGTGATAAGACGGGG
TGTGGCTCGGTTATTGTCACTGGGTCGCCCAATGTATTTATAGGTAACTAA