SecReT6
Protein ID: 186896061
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2756
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3053601..3056531 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB2K8L8
KEGG IDypb:YPTS_2756
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.70E-76, Aligned region: 18..336
Phage_base_V [PF04717], Evalue: 4.40E-24, Aligned region: 376..469
Protein Sequence: 976 a.a.     [Download]
>gi|186896061|ref|YP_001873173.1| ImpA family type VI secretion-associated protein [Yersinia pseudotuberculosis PB1/+]
MPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTIEMELDGNGLGD
VRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDIIEEVFSDYNFPF
EKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRSFSTAYHAIEYL
SDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHWPGDYDQPDIGE
HLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSGGEDAFSC
ESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGTNSESDSCWLRV
SQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGMVSRTVGGGLTN
YNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDVLGTSMLAIGAA
SMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATLAAGGPIAIGAG
GELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGAIALPLPLPLLP
IVVPPVTSPPDPTVPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPP
ETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTA
PPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPET
TAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPEPTRTPPGTQTPPP
 
Nucleotide Sequence: 2931 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c3056531-3053601 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGTCTAAGTTGGAAGGCGAGGAAGCTTTTTCGACTT
TATATTCTTATACTATTACGGCAAAGACACCGGCTAATCCATTAATTCCTTGGCAAGCGGCTTCAAATGT
CGATCTCAAATCCTTAATTGGTAAAGAGATGACGATTGAAATGGAACTGGACGGCAACGGCCTGGGTGAT
GTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGGGGCTGGTTGAGAGAGCCAGATACATTGGTCGAG
ATGCCAATCAGGCCATATTTGAGATCACTATTAAGCCTTGGTTCTACCTGGCTAATTTAACCTCTGACTT
TAAAATTTATCAAAATAAAAATGTCGTTGATATTATAGAGGAAGTGTTCTCAGACTATAATTTTCCGTTT
GAGAAACGGTTGGCTACAACCTATCCGATATTAGATTTTCAGGTTCAGTACGGTGAAACCGACTTTAATT
TCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTGGTTCTTTGAGCATCAGGATCATAAACAAAAATT
AATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCGTTCAGTACCGCCTACCATGCCATTGAGTACTTG
TCAGATGAGCCTAAAGCGGGCGAAGAGTACATCACACAATTCCAGACTCAGGAAACCTTGACGAGTGGGA
CCTGGGTCACCAACGATTATGACTTCACGAAATCCCGTGCCGATATTCTGGCAATGGACAGTAAACCGCG
TAAAACCAGCTTTAACGATCTCGAGATTTATCACTGGCCAGGGGATTATGATCAGCCAGATATTGGTGAG
CACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTCTGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGC
GCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGGGTTCCCCGTTGATAAAGCGAATCGGGAATACAT
GATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGATCAACTGTCTGGCGGTGAGGATGCGTTTAGTTGC
GAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCTATCGTCACCCACAGGTGACACCAAAACCGAAAA
CCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACCGGGTGAAGAGATTTGGACCGATGAATATGGCCG
CGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACAAACAGCGAGTCAGACTCTTGCTGGCTACGTGTT
AGCCAGGCTTGGGCAGGTAACAGCTTTGGTGGGATCTATATTCCACGCATTGGTCAGGAAGTCATTGTTG
ACTGTATTAACGGCGATCCTGACCGGCCAATGGTGATGGGCAGCCTTTATAATAACGTGACGCGTCCCCC
TTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATGGTCAGTCGTACTGTTGGCGGCGGGTTAACCAAC
TATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGGAGCAGTACTGGGAACAGGCCGAGCGCGATATGT
CGCGTTTGACTAAAAATAATGAAACGCAAATTATCGGTGCCGATTCGGTCCTGAATGTTGGGGCCAACCG
AAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTTCTTGGCACATCAATGTTAGCCATCGGTGCAGCC
TCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGGTTGGCGGAGCACATTCACTGAATGTGGTTTTGG
CGAATGCCACCAATGTGGGTGGCGCTAACATGACCAACGTAGGGGGATTTAATGGCCTTGCGGTGGGGGG
AGCCCATCAGACAGCTGTAGGTGGTGCTGCGACACTGGCGGCCGGCGGCCCTATTGCTATTGGGGCGGGT
GGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTGTTGGTAAAAGTAAGGTTATTATTCAGGGCGGTG
AAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAAAACGGGCAATGGCGGCGGGGCATTCGGTGCCTT
TGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCTATTGCCTTACCGCTACCGTTACCCTTGTTGCCA
ATAGTGGTGCCACCAGTGACATCGCCACCGGATCCAACAGTGCCACCGGATCCGACATTGCCACCAGATC
CAACGTTGCCACCAGATCCAACGTTACCGCCGGAAACAACGGCACCGCCGGAAACCACGGCACCGCCGGA
AACAACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACCACGGCACCGCCA
GAGACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACCACGGCACCGCCAGAGACAACGGCACCGC
CAGAGACAACGGCACCGCCGGAAACCACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACC
GCCAGAGACAACGGCACCGCCGGAAACCACGGCACCGCCAGAAACAACGGCACCGCCGGAAACAACGGCA
CCGCCGGAAACAACGGCACCGCCGGAAACCACGGCACCGCCGGAAACAACGGCACCGCCGGAAACCACGG
CACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCGCCAGAAACAAC
GGCACCGCCAGAAACAACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACA
ACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAA
CAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACCACGGCACCGCCAGAGACAACGGCACCGCCAGA
GACAACGGCACCGCCGGAACCGACGCGAACACCGCCAGGGACGCAGACGCCACCGCCTTGA