SecReT6
Protein ID: 186896063
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2758
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3060694..3062070 [-]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDB2K8M0
KEGG IDypb:YPTS_2758
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.20E-54, Aligned region: 86..291
OmpA [PF00691], Evalue: 3.40E-16, Aligned region: 352..450
Protein Sequence: 458 a.a.     [Download]
>gi|186896063|ref|YP_001873175.1| type VI secretion system OmpA/MotB family protein [Yersinia pseudotuberculosis PB1/+]
MSDSSDLNLGGSMPPFDQSRNVDESPQALGRFLLDEPMTYPDSTQDNAAFTREAPHSGAAQQYDTTLLRG
ESVQQRVAKVLASSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGMMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYADGLEVLLRILG
LGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALSPHGLIAHQNRRRRGIFVPVRVSMLLCGFLI
VATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLRLSILLKDEIAKQLVSVDETSNNSKVIFKGD
SMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPNNQVLSEKRAANVARYMEQAG
IPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c3062070-3060694 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAGTGACAGCAGTGATTTGAACCTTGGGGGCTCAATGCCTCCTTTTGATCAAAGCAGAAATGTGGATG
AGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAACCAATGACATACCCAGATAGCACTCAGGATAA
TGCGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTTACGGGGT
GAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCACAGCCAC
TATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAAAACAAAG
CCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAAAATGGCT
ATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATGATGGCAG
GTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTTTCTTATT
GGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCGGATGGTTTAGAGGTTTTGCTGCGCATTTTAGGG
CTCGGTTTTGAGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATTAACTAAAATACGCCAAGGGT
TGCTGACGCTGCTCCAAAGTACCCGAGACACGATCCCACCGGCACTTTCTCCGCATGGGTTGATCGCACA
TCAAAACAGAAGACGGCGGGGCATTTTTGTTCCGGTGCGCGTATCCATGCTGTTGTGTGGTTTCCTCATT
GTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAAGTGACTTGCTAAAAAGAATGGGAG
CATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGACTGTCTATTTTATTAAAAGA
TGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAGACGAGCAACAACAGCAAAGTCATCTTTAAAGGCGAC
TCCATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGTGATTAAACGCGTCGCGCAGG
AAGTGCATCGCGTTAAAGGGGCAATCCTCATTGTCGGGCATACAGACTCTATGCCGATTAATAAACCCGG
CTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCACGCTATATGGAACAGGCCGGT
ATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAACCGGTTAGCAGCAATGACGATGCGA
CAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTGA