SecReT6
Protein ID: 186896065
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2760
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3063420..3063980 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB2K8M2
KEGG IDypb:YPTS_2760
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.00E-36, Aligned region: 29..179
Protein Sequence: 186 a.a.     [Download]
>gi|186896065|ref|YP_001873177.1| hypothetical protein YPTS_2760 [Yersinia pseudotuberculosis PB1/+]
MILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIA
LYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAE
WKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 561 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c3063980-3063420 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGATTTTAATTAGGCTAAGTATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTT
TGGTACTGGTAACGTTATTGACGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAACTTAC
CGTCGAAATCGCGACAGCAGCGGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCG
CTTTATACACTCAAGAGCACCGATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGC
CATCGCTAAAAGAACAAATGGATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGA
GCTGACACTTGATGCTGGCGTTACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAG
TGGAAAGCGGTTATTTATCCGTTGCCCAAAAAGCGCGTGGACCCTTGGTATAAAAAAATGTGGCCAGGGC
AAGACCAACAAGATCCGATCATGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTA
A