SecReT6
Protein ID: 186896068
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2763
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3066577..3067101 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB2K8M5
KEGG IDypb:YPTS_2763
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-59, Aligned region: 11..164
Protein Sequence: 174 a.a.     [Download]
>gi|186896068|ref|YP_001873180.1| type VI secretion protein [Yersinia pseudotuberculosis PB1/+]
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNF
DERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQTYMDGKA
GAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
 
Nucleotide Sequence: 525 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c3067101-3066577 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGGTTAGCAAAAGTAATTCTCAAAAGTTTATTGCTCGAAACCGAGCGCCACGCGTGCAGATTGAATACG
ATGTGGAAATATACGGTAGTGAAAAGAAGGTTGAATTACCTTTCGTTATGGGGGTATTAGCAGATTTATC
CGGTAAACCTCTTGAGCCTTTACCTTCAGTCGCTGACAGAAAACTGTTAGATATCGATATTGATAATTTC
GATGAGCGTATGAAAGCAATGAAACCACGTGTTGCATTCGCCGTGCTGAATACATTGACTGGGGAAGGCC
AGTTAATGGTCGATATTACGTTTGAGAGTATGGATGATTTCTCTCCTGACGCTATCGCGAAAAAAGTTGA
TTCATTGTCTCAATTATTAGATGCCCGAACTCAACTTGCCAACTTGCAGACTTATATGGATGGTAAGGCG
GGTGCTGAGGAATTAGTCATGAAATTGCTGAAAGACAAATCATTACTGACAACGCTTGCATCCGCACCGA
AAGCAAAACAATCCGCTGTTGATACTCCACAGTAA