SecReT6
Protein ID: 186896074
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2769
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3075760..3077595 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB2K8N1
KEGG IDypb:YPTS_2769
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.80E-195, Aligned region: 1..610
Protein Sequence: 611 a.a.     [Download]
>gi|186896074|ref|YP_001873186.1| type VI secretion protein [Yersinia pseudotuberculosis PB1/+]
MREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPKFTQRLLDIVYPNYNS
PTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWPLEIAEARLSSVPPDM
PNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFELLHASHVATIIRAGHG
ETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQLSQSLRDNHTGEAEI
IILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSRPLDYEVFAINKVFGQ
QAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEVFVSLVDQQEAPYGDS
LRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDESAWRLIRQLSFNYLP
LSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVYGRGICCTLTVDEEGF
SGISPYLFGIIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|186893344|ref|NC_010634.1|:3075760-3077595 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGCGCGAAATGGCGCAAGAGTTTGCTGAAAAACATCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGA
TTGAAGTCGCCGATCCTTACGTTGAGCGGCTGATAGAATCCTTCTGTTTTTTATCTGCCAGAACGCAGAT
TAAGTTGGATGCTGAGTTTCCTAAATTTACTCAGCGTCTTTTGGACATCGTCTATCCCAATTACAATTCG
CCAACCCCCTCAATGGGCGTGATCCAACTTAAGCCAAATCTGAAGGAAGGGGATTTGACTCAAGGGTATT
GTGTTCCCAGGGGCAGCTCGTTCTTCACCCATATCGCACCTGGCGAAACAACCCGCTGCGAGTTCCGTAG
TGGTCAGGATGTGGAGTTGTGGCCACTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATG
CCTAATCTGGAAAAGCACCGTATTGCCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAG
TGGGCGATCTCACTTTCTCACAATTAGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACG
GATCGTTTCACATATCTTCGAGCTGCTCCACGCCAGCCATGTTGCTACCATCATACGGGCAGGCCACGGA
GAAACAGCAAAAGATACCGTGATCAGTGATCAGCCACTGTCCTTTGAAGGGCTAAGCCCCGACCAAAGCC
TACTGCCGCTATCATGGAATATCTTTCACGGACATAATCTGGTGCAGGAATACTTTACCTGCCGCCAGCG
TTTCTACTTTTTTACGCTGACACAGCTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGGAAATC
ATCATCCTACTGGACAGATTACCGCAGGATTTGGTGAGCCATGTTGCCCCCTCTCGTTTCCTGTTAGCCT
GCACGCCAGTGATTAATCTCTTTCCTAAACGCATGGATAAGATCGAAATTAACCGTGCATTGAACGATTT
TCACGTAGTACCAGACCGCAGCCGCCCACTGGATTATGAAGTTTTCGCCATTAATAAAGTATTTGGTCAA
CAGGCGGAAACCAGCAACGAGGTGGTATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACT
TTGGGCGTTATTTCTCCATCACCCGCAAGGCCAGAACGGGCGATAGCAACAAAAGAAAATATGACACCCG
CACGCCTTACGCCAGTACCGAGGTCTTTGTCTCGTTGGTCGATCAACAAGAGGCGCCTTATGGCGATAGC
CTGCGCTACCTCTCTATTGAAGCTCAGGTGACTAATCGGGATCTTCCGCGCCTGATTTCCGCCAGTGGTA
ATTTTGAATTGACCATGTCGGATTCAGCGCCCGTTCACGGTGCCCGGTTTGTGTTCCAACCCAGCGCCCC
ACGCGCCCCCTTTGCCATGGATGAATCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCA
CTGTCAGATATGTCCCACTCGAATGGGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTT
CAGACCATGAATCGAATACACAAATTGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTT
ACCCGGCAATGGCCTACTGGTTTATGGCCGGGGCATCTGCTGCACCTTGACCGTGGATGAAGAAGGATTC
TCCGGTATCAGCCCTTATCTATTTGGCATCATCATGGAAAATTATGTGGCCCGCCATGCCGCAATAAATG
TGTTTACCGAGACCGAGCTAAACTCCATGCAAAGAGGACGTGTCGGTCACTGGAAAGCCCGCCCTGGCAG
ACGAGGAGTCCTGTAA