SecReT6
Protein ID: 186896076
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2771
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3078719..3079912 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB2K8N3
KEGG IDypb:YPTS_2771
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.80E-18, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.80E-18, Aligned region: 203..215
Protein Sequence: 397 a.a.     [Download]
>gi|186896076|ref|YP_001873188.1| ImpA domain-containing protein [Yersinia pseudotuberculosis PB1/+]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKC
LELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELE
DIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALL
QGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPEPIETPDVVELYPVATAMLASTEMPVTAE
VQTVAETQMAIPIEAPQQRQAVVTPSPPLQPLQLQSAQLQPVPIQSPPVPVQQQGIQNRADALARLIEVR
EWFTAMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|186893344|ref|NC_010634.1|:3078719-3079912 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACT
TTCCTTGTGGCAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAGCCTAAGCA
GGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCTAATAACTGGACAGATATCGAGCGTAAATGC
CTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGG
TCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTTTGGTGCCTCGACACTTGGCCTGATCAGCT
ACATCCTCAGCTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTAATGCTTTTGCTGAACTGGAA
GACATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTGCAACTTTCCA
TCAAAGAGTTTGAAAAGGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTCAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTTTCACTCCAGCACGCTTATGCCTTGTTG
CAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCGG
TGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCTATCGTGGTGCCAGAACCTATTGAGACCCC
AGACGTTGTCGAGCTCTATCCGGTCGCCACAGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAG
GTACAGACGGTTGCAGAGACACAAATGGCCATACCCATTGAGGCTCCCCAACAGCGTCAAGCGGTGGTAA
CCCCATCCCCGCCGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCTGTACCGATACAGTCGCC
GCCGGTGCCTGTCCAACAGCAGGGGATCCAAAACAGGGCTGATGCGTTAGCCCGGCTTATAGAGGTGCGA
GAGTGGTTTACCGCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCG
GCAAAAGCTTCGGCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGA
GTAA