SecReT6
Protein ID: 186896079
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2776
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3083026..3084708 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDB2K8N6, B2K8N6
KEGG IDypb:YPTS_2776
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.10E-18, Aligned region: 190..232
OmpA [PF00691], Evalue: 3.10E-18, Aligned region: 441..539
Protein Sequence: 560 a.a.     [Download]
>gi|186896079|ref|YP_001873191.1| OmpA/MotB domain-containing protein [Yersinia pseudotuberculosis PB1/+]
MFKVKLNKTLSLLWLAAVGTLLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPNPPQVPIPVPQET
AEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSAQVLTFFPF
LPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEIT
QALQSLSQRLELQDINHSGFATQRNVMAHNLFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRH
GAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAIKPRVKTPVIKPIPASRGWLWSVCFAAVLLASHM
LNTLWQEKNRHAQFNQQMVPLDNINDFSAQYLARSITQLTDEGKTLTTCVNTFDVTRWGLSQCQTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVEQNKGKKILIVGHSDNTGSSSMNM
TLSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|186893344|ref|NC_010634.1|:3083026-3084708 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGTTTAAGGTTAAATTGAATAAAACGCTCTCTCTATTATGGCTGGCTGCGGTCGGCACCCTATTGGTGA
GTGTGAATTTTAAGGGAAATGCGTTATGGAATAACGTTATTTTCATTACTTTCCTGGCGCTGATGGTTCT
TGCCATCTGGAAACATTACGCCCTCAAACCCAACCCCCCCCAAGTGCCGATTCCCGTCCCGCAGGAGACA
GCAGAACCGGTAGAACAGGAAAGTACGGTTATTTTAATTCTCGGTCCCTATGCTGAGAAATGGTTTAGTA
ACCCAGAATCGCCAGACAGTACACGTTTTTCCAGCCATGCGGTCTGGATATTAATCACGAATCCCGCCGC
GCTGCAAAAACGCCTCACATATATTGCTGAACATCATCCATCCGCTCAGGTATTGACCTTTTTCCCTTTC
TTGCCGGATGTCTATGAGAATGCAGCGGTGATGATGTCAAAACTCACGGTGTGGCAGAACACGTTTTCAA
CGTTATCACTGCGATCCCCCCTCCCCTGCGTATTTGCTATTTATGCGCAGTTGAGTAATGAACGCCTTAG
CCATAATTCTGATAACGCATATTGGACTGGAAATATTAATCTTGCGAACCAGCAGCCTATCGAAATTACG
CAAGCCCTACAGTCACTGAGCCAAAGACTTGAGTTACAAGATATCAATCACTCAGGATTTGCAACTCAGC
GTAATGTTATGGCCCATAATTTATTTACCTGGTTGAATGAATCGGGGGTGACAAACCTTCTGCAATCTAT
TTTCTCGCGCACCCCCTTACGGCTAACAGACGTCATTTTGTCGGATAATGGCAAAGGGTTCATCAGGCAT
GGTGCCTGGTCAGCCTGGCTGGAGAAAAAGTTTGGCATCATACCGAGCTTAGCCTCAACCTTGTCACTGC
CACCTTTCCCTGCGGTGATCAATGACCAGAAGCCTGCAATAAAACCACGGGTGAAAACACCGGTGATAAA
ACCTATCCCCGCATCCCGTGGGTGGTTATGGAGTGTGTGCTTCGCCGCGGTGCTATTAGCCTCACATATG
CTAAACACCCTGTGGCAAGAAAAAAACCGGCATGCGCAATTTAACCAACAGATGGTGCCGTTGGACAATA
TCAACGATTTTTCTGCTCAGTACCTGGCACGCAGCATCACCCAGTTAACCGATGAAGGTAAAACATTAAC
CACCTGCGTTAATACATTTGATGTGACACGTTGGGGGCTGTCTCAATGTCAGACGTTATTAAGCCAAATC
AACCGCCGGATTGAATCCTATGAAAATATTCCTGTTTTCAGTTTTGCCCAAAAGCTCCCTCTGTTTGACT
CAAACAGTACCAAGCTGAAACTGAACTCACAAACCAATGAAATGATGATGGAGTTGTTATCACTGGTCGA
ACAGAATAAAGGGAAAAAAATCTTAATTGTTGGCCATTCTGATAACACGGGCAGTTCCTCCATGAACATG
ACACTTTCCGAACAGCGTGCGCTGGCCCTTCGCGATTGGTTAATTAAACGCAGTGATATCACTGTCGATA
ATTTTATTACCAAGGGAATGGGGGCTTCAGAACCGGTTGCGACCAATCACACGGAAGCGGGTCGAGAACA
AAACAGACGCGTCGAAGTACTGATATTACCCACACAAGATAGAACAAGAATGACGGAGCCTAAACCTTTA
TGA