SecReT6
Protein ID: 186896685
SecReT6 ID280
T6SS typei2
Gene symbol-
Locus tagYPTS_3385
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3743494..3745032 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB2K1G7
KEGG IDypb:YPTS_3385
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-174, Aligned region: 14..51
DUF877 [PF05943], Evalue: 1.40E-174, Aligned region: 90..508
Protein Sequence: 512 a.a.     [Download]
>gi|186896685|ref|YP_001873797.1| EvpB family type VI secretion protein [Yersinia pseudotuberculosis PB1/+]
MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSVFL
DLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELL
DISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHM
PFIGSVGPAFFGKENMEEVAAIKDIGNYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHERYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYAVP
HFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c3745032-3743494 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGGCACAAG
GGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGAGGCGTT
CCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTCTTTTTA
GACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATATTGCCG
CACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGTGGAATC
GACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAGCTGCTG
GATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTTTATACG
CCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAGCCGATTGCCGCGGCTATCTCCAACTACGA
GTTCGACCGCAGCCCGCAAGATATCGCCTTATTGCGCAATATCTCCAAAGTGGCGGCTGCAGCCCATATG
CCGTTTATCGGCTCAGTGGGTCCGGCGTTCTTTGGTAAAGAGAACATGGAAGAAGTGGCGGCGATTAAAG
ATATCGGCAACTACTTTGACCGCGCTGAATACATCAAATGGAAAGCTTTCCGCGACTCGGATGATTCCCG
CTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCTTATGGGCCAGACACCGTGCCGGTGCGC
AGCTTTAACTACGTAGAGCAGGTGAAAGGGCCGGATCATGAGCGTTATCTGTGGACCAACGCTTCGTTTG
CCTTTGCTGCCAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGTGGCCCGCAGGC
CGGTGGTGCGGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGACACCGC
GGATGCCACGGCCAACAGCCGCATCAACGCCCGTTTGCCGTATATCTTCCTGCTGTCGCGCATTGCCCAT
TATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTGAACAACT
GGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCATCCCCTGCGTGA
TGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTGTATGCGGTGCCG
CATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCAAAGGCTAAGGCATAA