SecReT6
Protein ID: 187476779
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0265
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]273187..273738 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ2L047
KEGG IDbav:BAV0265
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-54, Aligned region: 10..163
Protein Sequence: 183 a.a.     [Download]
>gi|187476779|ref|YP_784803.1| unnamed protein product [Bordetella avium 197N]
MSNSLQKWVGRNRAPRVQITYDVENGGAIEKKELPMVVGVMADLSGHPKEPLPKLKDRRFVEIDRDNFDE
ILDRIRPRLDLSVPDTAKGEGNLRIELEFSKFSDFHPESLVQQVPRLQRLLQARHQLRDLLAKLDGNDEL
DSILDRVIRSTEELRALHDEAGQAADDQAAEEKPADPPAAEPS
 
Nucleotide Sequence: 552 bp     [Download]
>gi|187476514|ref|NC_010645.1|:273187-273738 Bordetella avium 197N chromosome, complete genome
ATGTCCAATAGTTTGCAGAAATGGGTAGGGCGTAATCGGGCGCCTCGCGTCCAGATCACCTACGACGTGG
AAAACGGTGGGGCGATCGAGAAAAAAGAGTTGCCGATGGTGGTGGGTGTGATGGCAGATCTTTCCGGCCA
CCCGAAAGAACCCCTGCCCAAGCTCAAAGATCGTCGCTTCGTCGAAATAGACCGGGACAACTTCGACGAA
ATTCTCGATCGGATCAGGCCCCGTCTTGATCTGAGCGTGCCCGATACCGCCAAAGGCGAGGGCAATCTCC
GGATCGAGCTGGAGTTCTCCAAATTTTCTGACTTTCATCCCGAAAGCCTGGTGCAACAGGTGCCGCGCCT
GCAGCGCCTGCTTCAGGCGCGGCATCAATTGCGCGACCTCTTGGCAAAGCTGGATGGCAATGACGAACTG
GATTCGATTCTTGACAGGGTGATTCGCAGCACAGAGGAACTTCGTGCCTTGCACGATGAGGCCGGGCAAG
CGGCCGATGATCAAGCTGCAGAGGAGAAGCCTGCCGATCCTCCTGCCGCCGAACCAAGCTGA