SecReT6
Protein ID: 187476780
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0266
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]273790..275283 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ2L046
KEGG IDbav:BAV0266
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.60E-181, Aligned region: 70..492
Protein Sequence: 497 a.a.     [Download]
>gi|187476780|ref|YP_784804.1| unnamed protein product [Bordetella avium 197N]
MSNETLPETADAVQSSAELTLLDRIVLEGNMAVEPSQSGYAKQLIGQLASQILDEGMRTSPDKSVVAMIH
ERIAEIDALLSDQLNAIMHDPAFQQLEASWTGLHHFVSGTETSSRLKLRLLNVSKKDLLKDLESAVDHDM
SVLFKKVYEEEYGTFGGVPYSMLIGDYQFGRHPQDIALLERISRVASAAHAPFVAAAAPSLFDLKSFTDL
GVTRDLAKIFESAELERWRQFRDSEDSRYVCLVLPSYAARLPYGANSQPVDSFNFEEDVQDAKHGKYLWA
NAAYQLGLRITAAFAEHSWATAIRGVEGGGRVQGMAAHAYKTGEGDIAMKCPTEVTITDRREKELSDLGF
IALVNAKGTGEATFFGSQTVNRPKIYNTAAANANAQLSARLPYVLAASRFAHYIKVIMRDKIGSFQSRSD
VERYLNNWIADYVLINPSASHDQKASYPLSEARVDVTEVPGRPGAYRATCFLRPHYQMEELTASIRLVAD
LPAAASQ
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|187476514|ref|NC_010645.1|:273790-275283 Bordetella avium 197N chromosome, complete genome
ATGTCCAATGAAACGCTTCCGGAAACCGCCGACGCTGTGCAGTCCAGCGCAGAGTTGACCTTGCTTGATC
GTATCGTCCTCGAAGGGAATATGGCCGTTGAACCATCCCAGAGTGGTTATGCTAAGCAATTGATCGGGCA
GTTGGCGAGCCAGATCCTCGACGAGGGGATGCGCACCAGCCCCGATAAGTCTGTGGTCGCCATGATCCAT
GAGCGTATCGCCGAGATCGATGCGCTCTTGTCGGATCAGCTCAATGCCATCATGCATGACCCCGCCTTTC
AGCAACTAGAGGCTTCCTGGACGGGGTTGCATCACTTCGTGTCGGGCACGGAAACCAGTTCTCGCTTGAA
GCTGCGTCTGCTCAATGTCAGCAAAAAAGATCTGCTCAAGGATCTGGAAAGCGCGGTCGATCACGATATG
AGCGTGCTGTTCAAGAAAGTGTATGAAGAAGAGTACGGCACCTTTGGCGGCGTGCCCTACAGCATGCTGA
TCGGCGACTATCAGTTTGGCCGTCATCCACAGGATATTGCCCTGCTAGAACGCATTTCACGCGTGGCCTC
GGCCGCGCATGCGCCATTCGTGGCTGCGGCGGCTCCTTCGTTGTTCGATCTGAAGTCATTCACCGATCTC
GGTGTGACGCGAGATCTGGCCAAAATATTCGAGAGCGCCGAGCTTGAACGCTGGCGGCAGTTCAGGGATA
GCGAAGATTCGCGCTATGTCTGCCTGGTTCTGCCTTCTTATGCGGCACGGCTTCCTTATGGAGCGAATTC
GCAGCCGGTCGATTCCTTCAATTTTGAGGAAGATGTCCAGGACGCCAAACACGGTAAGTATCTTTGGGCG
AACGCGGCCTACCAGCTGGGCTTGCGTATCACTGCGGCATTTGCCGAACACAGCTGGGCCACGGCCATTC
GGGGTGTGGAAGGTGGAGGCCGGGTTCAGGGCATGGCTGCTCATGCCTATAAAACCGGCGAGGGCGATAT
CGCCATGAAATGTCCGACCGAGGTCACGATTACCGATCGACGCGAGAAAGAACTCAGCGACCTGGGCTTC
ATCGCTCTGGTCAATGCCAAGGGCACGGGTGAGGCAACTTTTTTCGGCAGCCAGACGGTTAACCGCCCCA
AAATCTACAACACGGCTGCGGCGAACGCCAATGCCCAGCTATCCGCTCGCCTGCCGTATGTGCTGGCGGC
CTCCCGTTTCGCGCATTACATCAAGGTCATCATGCGCGACAAGATCGGCAGCTTTCAGTCTCGCTCGGAC
GTGGAACGCTATCTCAATAACTGGATCGCGGATTACGTCCTGATCAATCCCTCGGCCTCACATGACCAGA
AGGCCAGCTATCCCTTGAGTGAGGCGAGAGTGGATGTCACCGAAGTGCCAGGCCGCCCCGGCGCTTACCG
GGCGACCTGCTTTCTACGGCCTCATTACCAGATGGAAGAGCTCACGGCTTCTATCCGTTTGGTGGCTGAT
CTTCCTGCCGCCGCCAGTCAATGA