SecReT6
Protein ID: 187476781
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0267
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]275344..275820 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ2L045
KEGG IDbav:BAV0267
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-30, Aligned region: 4..134
Protein Sequence: 158 a.a.     [Download]
>gi|187476781|ref|YP_784805.1| unnamed protein product [Bordetella avium 197N]
MNIYLKIKDIKGNSLVDPYVGYIVLDSYSLGVSQPVSHDVGNSERTLGRPDFRLLSCSKQTDQSSPALMG
ACAGGKKLGEVELIVARNADDKSLNRICVTMGNCIIASYDMSGGGGMESDSFTISFTSIKFEYTQQGPTG
EKKGNASMGWDLETNKAL
 
Nucleotide Sequence: 477 bp     [Download]
>gi|187476514|ref|NC_010645.1|:275344-275820 Bordetella avium 197N chromosome, complete genome
ATGAACATCTATCTGAAGATCAAGGACATCAAGGGAAACAGCCTGGTTGACCCCTACGTGGGTTATATCG
TTCTCGATAGCTATTCGCTGGGTGTCTCGCAACCCGTCTCGCACGATGTGGGGAATTCAGAGCGCACGCT
AGGGCGACCGGATTTCCGCCTGTTGTCGTGCTCCAAGCAAACCGATCAGTCCAGTCCGGCGCTGATGGGG
GCTTGCGCGGGCGGCAAGAAGCTGGGAGAGGTCGAGTTGATCGTGGCGCGCAATGCAGATGACAAGTCCT
TGAATCGCATCTGCGTAACCATGGGCAATTGCATCATCGCCAGCTACGACATGAGCGGTGGCGGCGGCAT
GGAAAGCGACAGTTTCACCATTTCGTTTACCAGCATCAAGTTTGAGTACACCCAGCAGGGTCCGACCGGC
GAGAAGAAGGGTAATGCGTCGATGGGCTGGGATCTCGAAACCAACAAAGCGCTCTGA