SecReT6
Protein ID: 187476783
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0269
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]276250..277992 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ2L043
KEGG IDbav:BAV0269
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.40E-155, Aligned region: 6..579
Protein Sequence: 580 a.a.     [Download]
>gi|187476783|ref|YP_784807.1| unnamed protein product [Bordetella avium 197N]
MLSDEFLKYYRRELAYLREQGADFAQRYPKVAGKLGLHGGESPDPHVERLLESFAFLSARVHREIDQTLP
QLASDLLENLCPALALPVPSMSIAQLHLELSQGKVTAGFSLPKGAELVARSAGKENCRFQTVWDSRLWPL
HLRGIRSLDERTLSLELEADAGLTLAELDIRSLRVHLAGDWMEAAPLYEWLVGGVIGTDLIVDDHRVSAG
EWREVGFDHGEEALPRHGYAHPAHLLLQEIFAFPRKFHFFDLGLPQGLPLPGSRCEIRVNLRRPLRGNRG
PHEGSFKLGCVPIVNLFGSTSEPVALDQKAYEYPLSASWQDSETVEIFRVEKVYLSDPMAERTVEVPNFS
SQQHLIQPEPPMFWTSRRQLSFRPNGGTDTFISFIDSRQRAMAPAVPVAYANLWCTNRRLAEQVPAGASL
LFEKVRSNLSATCLYEPTAQRDPPLDAGQLWQLAAFVTSQQQSLFEPGGSSQRLQDLMRLFAGSSAREIG
MIQGLLSAQATEASIPVSRGSWRGYQLGTDVTLEFDPQAYVGSSPLLLAAGLARFFALTTSINSFVRTQV
RLRDEIWRAWPPMSGYEAIL
 
Nucleotide Sequence: 1743 bp     [Download]
>gi|187476514|ref|NC_010645.1|:276250-277992 Bordetella avium 197N chromosome, complete genome
ATGCTTAGCGATGAATTTCTCAAGTATTACCGGCGAGAGTTGGCGTATTTAAGAGAGCAGGGCGCTGATT
TCGCTCAGCGCTATCCCAAGGTGGCCGGAAAACTGGGTCTGCATGGGGGCGAGTCTCCCGACCCTCATGT
CGAGCGCCTGCTGGAGTCTTTTGCTTTCCTTTCGGCCAGGGTGCATCGAGAGATTGATCAGACCTTGCCG
CAGTTGGCTTCGGATCTTCTTGAGAATCTCTGCCCTGCGCTGGCTTTGCCAGTCCCGTCTATGTCGATTG
CGCAGTTGCACCTGGAACTCAGCCAGGGCAAGGTCACCGCAGGTTTCTCGCTACCCAAGGGGGCTGAGTT
GGTGGCGCGCAGCGCCGGCAAGGAAAACTGCCGTTTTCAAACCGTCTGGGACAGCCGCTTATGGCCGCTG
CATTTGCGCGGTATACGTAGTCTTGATGAGCGGACGCTGTCGTTGGAGCTGGAGGCCGATGCGGGCTTGA
CGCTGGCGGAGCTGGATATACGCAGTCTGCGGGTGCATCTTGCTGGCGACTGGATGGAGGCTGCGCCCTT
GTATGAGTGGCTGGTCGGCGGCGTGATCGGCACGGACCTGATCGTGGACGACCACCGTGTGTCGGCGGGG
GAGTGGCGAGAAGTGGGCTTTGACCACGGCGAAGAAGCCTTGCCGCGCCACGGTTACGCCCATCCGGCGC
ATTTACTTTTGCAGGAAATTTTCGCTTTTCCCCGCAAATTCCATTTCTTCGACCTCGGGTTGCCGCAGGG
CCTTCCACTGCCCGGCAGCCGTTGTGAGATCCGCGTGAATTTGCGGCGTCCTTTGCGGGGAAACCGTGGC
CCTCACGAAGGGAGTTTCAAGCTGGGCTGCGTGCCGATTGTCAATCTGTTCGGCAGCACTAGCGAACCGG
TAGCTTTAGATCAGAAGGCCTATGAGTATCCGCTGAGCGCCAGTTGGCAAGACAGCGAGACCGTCGAGAT
ATTCCGTGTTGAAAAGGTATATCTGTCTGATCCGATGGCGGAGCGCACCGTGGAAGTGCCGAATTTTTCT
TCGCAGCAGCATCTGATACAACCTGAGCCACCGATGTTCTGGACCAGCCGGCGGCAACTCAGTTTCCGGC
CCAATGGCGGAACCGACACCTTTATCAGTTTCATTGATTCGCGCCAGCGTGCCATGGCGCCGGCAGTGCC
GGTCGCCTATGCCAATTTATGGTGCACCAATCGCAGGCTCGCCGAGCAAGTGCCGGCAGGCGCCAGTCTC
TTGTTCGAGAAGGTGCGCTCCAACCTGAGCGCGACATGTCTTTATGAGCCGACGGCGCAGCGAGACCCAC
CGCTGGATGCCGGACAGCTCTGGCAACTGGCCGCCTTTGTGACCTCGCAACAGCAATCACTTTTTGAACC
GGGTGGCAGTAGTCAAAGGTTGCAGGATCTGATGCGGCTGTTCGCGGGTAGTTCCGCGCGTGAGATCGGA
ATGATTCAAGGCCTGTTGAGTGCGCAGGCGACTGAGGCCAGCATTCCCGTCTCTCGAGGGAGTTGGCGCG
GCTATCAGCTTGGCACGGATGTGACGCTGGAGTTCGACCCGCAAGCCTATGTCGGCAGTTCGCCGCTGTT
GCTGGCAGCCGGGCTGGCGCGGTTTTTCGCGCTGACGACCTCGATCAATTCTTTTGTGCGCACCCAGGTT
CGGCTGCGCGATGAGATCTGGCGTGCCTGGCCGCCGATGTCGGGTTACGAGGCCATCCTATGA