SecReT6
Protein ID: 187476784
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0270
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]277989..278903 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ2L042
KEGG IDbav:BAV0270
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.60E-62, Aligned region: 7..285
Protein Sequence: 304 a.a.     [Download]
>gi|187476784|ref|YP_784808.1| unnamed protein product [Bordetella avium 197N]
MSHDLLARPYQFNFFQAVRLLEQMSGKQGGRAVRFRTRVGISFDASDVLAISRNGEGPFELTSNVLCIAG
ANGPLPLPYTEQVLQARERGDSSASDFLDIFNHRLMLMLFRARRRCYPALLGQGVEAPIWQVLRALTHLP
ADVEPLGAPASALLAIRTRSLAGLQTLIAERLHLRVRGASMQGGWIALDQATRARLGAASRLSDTALGSR
AWNPAAGIALTLMPRHADAFTDVEAQALSAGGEGYRLLVACLRAYLRAPLDVEVRLAPTAGPVTRPRLGW
SSWLGKACRQSPRFRLRGVPLHKG
 
Nucleotide Sequence: 915 bp     [Download]
>gi|187476514|ref|NC_010645.1|:277989-278903 Bordetella avium 197N chromosome, complete genome
ATGAGTCATGACTTGCTGGCGCGGCCCTATCAATTCAATTTCTTTCAGGCAGTGCGTTTGCTTGAGCAGA
TGAGCGGCAAGCAAGGCGGGCGCGCCGTGCGCTTTCGGACACGCGTTGGCATCAGTTTTGACGCCAGCGA
TGTGCTGGCTATTTCGCGCAATGGCGAGGGGCCGTTCGAGCTGACCAGCAATGTGCTTTGTATTGCCGGT
GCCAATGGCCCCTTGCCTTTGCCCTATACCGAGCAGGTGCTCCAGGCGAGGGAGCGTGGTGATAGCTCGG
CAAGCGATTTTCTGGATATTTTCAACCATAGATTGATGCTCATGCTGTTCCGGGCCCGGCGTCGTTGCTA
CCCGGCCTTGCTCGGACAGGGCGTGGAGGCGCCGATTTGGCAGGTCTTGCGGGCGCTGACGCATCTTCCT
GCCGATGTGGAGCCGCTGGGCGCGCCCGCTTCGGCCTTGCTCGCAATACGCACCCGTTCTCTGGCCGGAC
TGCAAACGCTGATCGCCGAACGCCTGCATTTGCGGGTGAGGGGGGCGTCGATGCAGGGAGGCTGGATTGC
CTTGGACCAGGCCACGCGCGCGCGGCTGGGTGCTGCTTCACGCTTGTCGGATACCGCTTTAGGTAGCCGG
GCATGGAATCCGGCAGCGGGTATTGCGTTGACGCTCATGCCCAGACACGCCGACGCATTCACGGATGTCG
AAGCCCAGGCTTTAAGCGCCGGAGGCGAGGGATATCGGCTGCTCGTCGCCTGTTTGCGCGCTTATCTCCG
AGCGCCACTCGATGTTGAGGTCAGGTTGGCGCCGACGGCAGGACCTGTTACACGGCCTCGCTTGGGGTGG
TCCAGCTGGCTGGGGAAGGCTTGCAGACAATCACCAAGATTCCGCTTGCGCGGGGTCCCTTTGCATAAAG
GATAA