SecReT6
Protein ID: 187476785
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0271
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]278906..281524 [+]
ProductATPase with chaperone activity
NoteTssH
UniProt IDQ2L041
KEGG IDbav:BAV0271
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.20E-41, Aligned region: 212..234
AAA_2 [PF07724], Evalue: 9.20E-41, Aligned region: 597..761
AAA [PF00004], Evalue: 7.50E-21, Aligned region: 213..345
AAA [PF00004], Evalue: 7.50E-21, Aligned region: 603..725
AAA_5 [PF07728], Evalue: 4.80E-15, Aligned region: 213..235
AAA_5 [PF07728], Evalue: 4.80E-15, Aligned region: 299..343
AAA_5 [PF07728], Evalue: 4.80E-15, Aligned region: 602..722
ClpB_D2-small [PF10431], Evalue: 1.40E-13, Aligned region: 769..839
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 48..67
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 93..143
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 190..235
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 256..292
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 403..474
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 571..638
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 667..691
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 744..753
AAA_22 [PF13401], Evalue: 5.00E-10, Aligned region: 212..299
AAA_22 [PF13401], Evalue: 5.00E-10, Aligned region: 330..409
AAA_22 [PF13401], Evalue: 5.00E-10, Aligned region: 455..469
AAA_22 [PF13401], Evalue: 5.00E-10, Aligned region: 601..691
AAA_17 [PF13207], Evalue: 3.40E-07, Aligned region: 213..255
AAA_17 [PF13207], Evalue: 3.40E-07, Aligned region: 601..639
Sigma54_activat [PF00158], Evalue: 6.40E-07, Aligned region: 208..232
Sigma54_activat [PF00158], Evalue: 6.40E-07, Aligned region: 602..723
NACHT [PF05729], Evalue: 7.80E-06, Aligned region: 213..241
NACHT [PF05729], Evalue: 7.80E-06, Aligned region: 602..626
AAA_14 [PF13173], Evalue: 8.30E-06, Aligned region: 213..316
AAA_14 [PF13173], Evalue: 8.30E-06, Aligned region: 601..683
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 195..233
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 602..620
Arch_ATPase [PF01637], Evalue: 1.50E-05, Aligned region: 192..232
Arch_ATPase [PF01637], Evalue: 1.50E-05, Aligned region: 267..364
Arch_ATPase [PF01637], Evalue: 1.50E-05, Aligned region: 601..640
Arch_ATPase [PF01637], Evalue: 1.50E-05, Aligned region: 664..695
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 213..235
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 600..624
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 213..236
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 601..642
AAA_25 [PF13481], Evalue: 3.40E-05, Aligned region: 208..237
AAA_25 [PF13481], Evalue: 3.40E-05, Aligned region: 600..620
AAA_29 [PF13555], Evalue: 3.80E-05, Aligned region: 205..228
AAA_29 [PF13555], Evalue: 3.80E-05, Aligned region: 600..628
AAA_18 [PF13238], Evalue: 0.00011, Aligned region: 213..236
AAA_18 [PF13238], Evalue: 0.00011, Aligned region: 603..627
SRP54 [PF00448], Evalue: 0.00069, Aligned region: 213..236
SRP54 [PF00448], Evalue: 0.00069, Aligned region: 446..499
SRP54 [PF00448], Evalue: 0.00069, Aligned region: 601..629
RNA_helicase [PF00910], Evalue: 0.00069, Aligned region: 214..235
RNA_helicase [PF00910], Evalue: 0.00069, Aligned region: 603..624
RNA_helicase [PF00910], Evalue: 0.00069, Aligned region: 699..720
AAA_23 [PF13476], Evalue: 0.0013, Aligned region: 213..229
AAA_23 [PF13476], Evalue: 0.0013, Aligned region: 447..515
AAA_23 [PF13476], Evalue: 0.0013, Aligned region: 600..626
T2SE [PF00437], Evalue: 0.0037, Aligned region: 199..234
T2SE [PF00437], Evalue: 0.0037, Aligned region: 597..671
MobB [PF03205], Evalue: 0.0039, Aligned region: 214..245
MobB [PF03205], Evalue: 0.0039, Aligned region: 601..633
Clp_N [PF02861], Evalue: 0.0042, Aligned region: 23..74
Clp_N [PF02861], Evalue: 0.0042, Aligned region: 103..126
DUF258 [PF03193], Evalue: 0.005, Aligned region: 209..236
DUF258 [PF03193], Evalue: 0.005, Aligned region: 601..617
DUF815 [PF05673], Evalue: 0.0062, Aligned region: 207..288
DUF815 [PF05673], Evalue: 0.0062, Aligned region: 562..634
AAA_30 [PF13604], Evalue: 0.0074, Aligned region: 200..235
AAA_30 [PF13604], Evalue: 0.0074, Aligned region: 601..626
Protein Sequence: 872 a.a.     [Download]
>gi|187476785|ref|YP_784809.1| unnamed protein product, partial [Bordetella avium 197N]
VATDIRTLLTRMNAVCKTAMEEAAQLCVRQTHHTVEVEHLLLALQEARAPDLELLIERMGVDREMLSAQL
KRSIDAFKRGNPRTPALSPYFAAWFEEALLQSALLLGEQQIRSGTLLVALLEKDELRQAILVSAPSLLNI
PREQLRAVLPDALAAGQEGGSVAERGATSALSQYTVNLTEIALAGGLDPVTGRDAEIRQLIDVLLRRRQN
NPILTGEAGVGKTAVVEGLAQRIAQGTVPPSLKDVQLCTLDLALLQAGAGVRGEFENRLKGVMAEVKSSP
RPIVLFIDEAHQLIGAGGTEGQGDAANLLKPALARGELRTIAATTWAEYKRYVERDPALARRFQVIKVDE
PSEDTAVEMLRAVVPRLLQHHQVEVLDSAVRDAVRLSHRYLSGRQLPDKAVSVLDTACAIVASAHNGPPQ
ALETLDRQLELARGRLNLLRHEVAKGQGNPAEVEQLTQRIEELAAEKTHLLDRLDNERLAVQQIRAWRAR
IEQAVQAEAGAEELRDMTNNLLRLEKGLEVLQADEALVPSCVDSSVVARVISGWTGIPVGRMLTDELHTV
LNLEDRLRERVVGQDAALDAIARRVRTFRAELDDPGKPVGVFLLVGPSGVGKTETATALADILYGGERNM
ITINLSEYQEAHSVSGLKGAPPGYVGYGKGGVLTEAVRRRPYSVVLLDEIEKAHPDVLELFFQVFDKGEM
EDGEGTPIDFRNTLIILTSNAAQDVITDACAGEVWPDAQALRERLHAALSRQFGPAFLGRTVVVPYYPLQ
DVQLERIVRLKLNKIAERIRLNHGAEFEWTPEVSQQIARRCREVDSGARNVDHILTQVVLPEIASQVLDC
LSTGAEFALVRLSVDSSGNFVFGLTAKEAEHD
 
Nucleotide Sequence: 2619 bp     [Download]
>gi|187476514|ref|NC_010645.1|:278906-281524 Bordetella avium 197N chromosome, complete genome
GTGGCTACAGATATACGAACCCTGCTGACCCGCATGAATGCGGTGTGTAAAACGGCAATGGAAGAGGCGG
CCCAGTTGTGCGTCCGACAGACGCACCACACTGTGGAAGTCGAGCACCTTTTACTCGCTTTGCAGGAGGC
CAGAGCTCCGGACCTGGAGCTGTTGATCGAGCGTATGGGGGTAGACCGGGAGATGTTGTCCGCTCAGCTA
AAGCGATCGATCGATGCCTTCAAGCGTGGTAATCCCCGTACGCCTGCGTTATCGCCTTATTTCGCGGCCT
GGTTTGAAGAGGCCTTGTTGCAAAGCGCCTTGTTGTTAGGCGAGCAGCAGATTCGTTCCGGCACCTTGCT
GGTTGCGCTGCTGGAGAAAGACGAATTACGCCAGGCGATTCTGGTCAGCGCGCCCTCCCTGCTCAATATC
CCGCGCGAACAACTGCGCGCGGTCTTGCCGGATGCGCTAGCTGCGGGACAGGAGGGTGGCTCGGTCGCCG
AGCGTGGAGCGACGTCGGCGCTCTCGCAGTACACGGTAAACCTGACCGAAATCGCGCTGGCAGGGGGGTT
AGACCCGGTGACCGGGCGCGATGCCGAGATTCGGCAATTGATCGACGTGCTCTTACGTCGGCGTCAGAAC
AACCCTATCCTGACTGGCGAGGCCGGCGTCGGTAAAACGGCTGTCGTGGAGGGCTTGGCGCAGCGCATCG
CGCAAGGGACTGTGCCGCCTTCTTTGAAGGATGTGCAGCTATGCACGCTGGATCTCGCCTTGTTGCAGGC
CGGCGCAGGCGTGCGCGGCGAATTTGAAAACCGACTCAAAGGCGTGATGGCAGAGGTGAAGTCCTCCCCA
CGGCCCATCGTACTTTTCATCGATGAAGCTCATCAGCTGATAGGGGCAGGGGGCACGGAGGGCCAGGGGG
ACGCGGCCAACCTGCTCAAGCCTGCTTTGGCCAGGGGGGAACTGCGCACCATCGCGGCGACCACCTGGGC
GGAATACAAACGCTATGTCGAGCGCGATCCCGCCTTGGCCAGGCGCTTTCAGGTCATCAAGGTGGATGAG
CCCTCCGAGGACACGGCAGTGGAGATGCTGCGCGCGGTTGTGCCACGTCTGTTGCAGCATCATCAGGTGG
AAGTTCTCGATAGCGCCGTGCGCGATGCGGTGCGTCTTTCTCATCGCTATCTGTCGGGCAGGCAGTTGCC
GGACAAGGCGGTGAGTGTGCTGGATACGGCCTGCGCTATTGTCGCCTCTGCCCACAACGGGCCGCCCCAG
GCCTTGGAGACGTTGGACCGTCAGCTCGAACTGGCGCGCGGTCGTCTGAATCTGCTGCGCCATGAGGTGG
CGAAAGGCCAAGGCAACCCCGCCGAAGTGGAGCAACTGACCCAGCGCATAGAAGAGCTTGCCGCAGAGAA
GACGCATTTGCTGGATCGCCTCGACAATGAACGCCTGGCAGTGCAACAGATCAGAGCCTGGCGTGCTCGG
ATCGAGCAGGCCGTGCAAGCGGAGGCGGGCGCCGAGGAGTTGCGCGACATGACGAACAATTTGCTGCGTC
TCGAAAAAGGTCTGGAGGTACTGCAGGCCGATGAGGCGCTGGTGCCCAGTTGCGTTGACTCCTCTGTTGT
TGCCCGGGTTATTTCCGGCTGGACCGGTATACCCGTGGGGCGGATGCTTACCGATGAGCTGCATACGGTG
CTCAATCTCGAAGACCGGCTGCGCGAGCGGGTCGTGGGGCAGGACGCTGCGCTAGATGCGATTGCACGGC
GGGTGAGGACGTTTCGCGCCGAACTCGATGATCCGGGCAAGCCTGTGGGCGTATTTCTGCTGGTGGGGCC
CAGCGGCGTGGGCAAAACGGAGACCGCTACGGCGCTGGCCGATATTCTTTATGGCGGCGAACGCAACATG
ATCACTATCAACTTGTCGGAGTACCAGGAGGCCCACAGCGTTTCGGGCCTGAAGGGTGCGCCGCCGGGTT
ATGTGGGCTATGGCAAGGGCGGTGTCTTGACCGAGGCGGTCCGGCGCAGGCCGTATAGCGTGGTGTTGCT
GGACGAGATAGAGAAGGCACATCCCGATGTGCTGGAGCTTTTCTTCCAGGTGTTCGACAAAGGAGAAATG
GAAGACGGTGAGGGCACGCCGATTGATTTTCGCAACACCCTCATCATTCTGACCTCCAATGCTGCGCAGG
ATGTCATTACTGATGCCTGCGCGGGCGAGGTGTGGCCCGATGCCCAAGCGCTGCGCGAGCGCTTGCACGC
TGCGCTGTCTCGGCAATTCGGCCCTGCCTTTCTGGGGCGAACGGTTGTCGTTCCTTATTACCCGCTGCAA
GACGTCCAGTTAGAGCGCATTGTCAGGCTGAAGCTGAACAAAATCGCTGAGCGCATACGGCTCAACCACG
GGGCCGAGTTCGAGTGGACGCCGGAGGTCTCGCAGCAGATCGCACGCCGCTGCCGAGAAGTCGATAGCGG
TGCGCGCAATGTGGACCACATTCTCACGCAGGTGGTTCTGCCCGAGATTGCCAGCCAGGTGCTGGACTGC
CTGTCCACAGGCGCCGAGTTCGCCCTTGTGCGTCTGAGCGTGGACAGTAGCGGAAACTTTGTCTTTGGCT
TGACCGCTAAGGAAGCAGAGCATGACTGA