SecReT6
Protein ID: 187476786
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0272
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]281517..283367 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ2L040
KEGG IDbav:BAV0272
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-66, Aligned region: 29..321
Phage_base_V [PF04717], Evalue: 1.10E-22, Aligned region: 349..438
Protein Sequence: 616 a.a.     [Download]
>gi|187476786|ref|YP_784810.1| unnamed protein product [Bordetella avium 197N]
MTEVQHRWLGSVDTSLGQNVLLLEALRGTEALSALFDFRLRLRSEKLDIDPKALLGSQMTVRLQRPGSRA
RFLHGLVTRFGHLGADARNAWYEARLQPRMCLMAEGRDRKIFQDMTVPEILRKVLDQHAIRVTPKLRDTN
YPRREYCVQFDESPLDFVSRLMEEEGIFYFFDFSESGHTLILADSPAAHRECAGASELVYAPQGPDKPGL
FDLALSAEVEGPAPVLADYDYLNATVLHTDGAKAQGGRLYCYPGRYTQEGEGKRKADILAAALQLRRESG
SARSESPALCAGAKFRLRGHPDSRYDQSYILKTVAHDFRQGEYHNQVDIFPESLPFRSLPLTARPKVAGT
HTGVVVGPSGEEIWTDDHGRIKVKFHWDDGPEKNQDASCWMRVTQPLAGQGWGAWFLPRVGQEVLVAYAD
GDPDQPLVVGTLYNVKQTLPLQLPYQQTQTVLRSRSTPSGQAGNELRMEDRAGEEQFYLRAQKDMKVEAQ
SQLFTQVGEGETHSIEKGDRVIRVADGNERHEVQGKREINVTGDETHLNGARFSREVAGDYVLTVSGNLT
LDVRGMLTIKTIGGYSLESSSTVSVKGLSIEQKASATQTLDGGGLLLVKGGLVKVN
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|187476514|ref|NC_010645.1|:281517-283367 Bordetella avium 197N chromosome, complete genome
ATGACTGAGGTTCAGCATCGTTGGTTGGGTTCAGTCGATACCTCCCTCGGTCAGAACGTTTTGTTGCTGG
AGGCGTTGCGGGGCACCGAGGCGCTATCGGCCCTCTTTGACTTTCGCTTGCGTTTGCGCTCCGAGAAGCT
CGACATCGATCCCAAAGCGCTCCTCGGCAGCCAGATGACGGTGCGATTGCAGCGGCCCGGCAGCCGTGCG
AGGTTTTTGCATGGTCTGGTAACGCGTTTCGGCCACCTTGGGGCCGACGCGCGCAATGCCTGGTACGAGG
CCCGCTTGCAGCCGCGCATGTGTTTGATGGCCGAGGGCCGGGATCGCAAAATCTTTCAGGACATGACCGT
GCCTGAGATTCTGCGCAAAGTGCTGGATCAACACGCTATCCGCGTCACCCCCAAGTTGCGTGACACGAAC
TATCCCCGGCGTGAATATTGTGTGCAGTTTGATGAGAGCCCTCTGGATTTTGTTTCGCGTCTGATGGAAG
AAGAGGGGATTTTCTATTTCTTCGATTTCTCGGAGAGCGGCCATACCTTGATTTTGGCGGACTCACCCGC
CGCGCATCGTGAATGCGCTGGCGCATCGGAGCTTGTTTATGCGCCTCAAGGGCCGGATAAGCCGGGGTTG
TTCGATCTTGCCCTGTCGGCCGAGGTGGAGGGCCCTGCCCCGGTGTTGGCTGATTATGACTACCTGAACG
CCACGGTTTTGCATACCGATGGGGCGAAAGCCCAGGGAGGGCGGCTTTACTGCTACCCGGGCAGGTATAC
CCAAGAAGGGGAGGGTAAACGCAAGGCGGACATTCTGGCGGCTGCGCTCCAGTTGCGTCGAGAAAGCGGG
TCCGCCCGCAGCGAAAGTCCGGCGCTGTGCGCCGGCGCCAAGTTCCGCCTGCGCGGCCACCCTGATTCGC
GCTATGACCAGAGCTATATCCTGAAAACGGTGGCCCATGATTTTCGTCAAGGTGAATACCACAATCAGGT
CGATATCTTTCCGGAGTCCTTGCCGTTTCGCTCCTTGCCCCTGACCGCGCGGCCTAAGGTAGCCGGAACG
CACACCGGCGTTGTGGTAGGCCCGTCTGGCGAGGAAATCTGGACGGATGATCATGGCCGCATCAAGGTCA
AGTTTCATTGGGATGATGGTCCGGAGAAAAACCAGGATGCCTCGTGTTGGATGCGGGTGACTCAGCCGCT
GGCGGGACAGGGGTGGGGCGCCTGGTTCCTGCCCAGAGTGGGGCAGGAGGTGCTGGTTGCCTATGCCGAC
GGTGATCCGGATCAGCCATTAGTGGTAGGCACGCTCTACAACGTCAAACAAACGCTGCCATTGCAACTCC
CCTATCAGCAGACGCAGACGGTGCTGCGCTCCCGATCGACGCCTTCGGGCCAGGCGGGTAACGAGCTGCG
GATGGAGGATCGCGCGGGTGAAGAGCAGTTCTATCTGCGCGCGCAAAAAGACATGAAGGTCGAGGCTCAA
TCTCAACTCTTCACCCAGGTTGGTGAGGGAGAAACCCATTCCATTGAAAAGGGTGATCGCGTGATTCGCG
TTGCCGATGGCAACGAGCGGCATGAGGTCCAGGGAAAACGAGAGATCAACGTGACGGGTGACGAAACGCA
TCTCAATGGAGCGCGGTTCAGCCGTGAAGTGGCCGGCGATTATGTGCTCACTGTGTCCGGAAACTTGACG
CTTGATGTACGAGGCATGCTAACGATAAAGACAATAGGCGGTTACAGCCTGGAATCCTCCTCCACGGTGA
GTGTTAAAGGCCTGTCTATAGAGCAAAAGGCATCTGCCACACAGACCTTGGATGGCGGCGGTCTATTGCT
CGTCAAGGGTGGGCTTGTGAAGGTGAACTGA