SecReT6
Protein ID: 187476794
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0280
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]288651..289940 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ2L030
KEGG IDbav:BAV0280
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.20E-40, Aligned region: 23..395
Protein Sequence: 429 a.a.     [Download]
>gi|187476794|ref|YP_784818.1| unnamed protein product, partial [Bordetella avium 197N]
VGKNAQVVDRIAWHEGMLLAPQHFQQLSARVDSLVAAQTLAAQPLAWGLSHLVLDEQLLPVGRLRVLELE
AVLADGTLVSYSALAGTPLEVDLGPFESAMQQEGVDVYLTLALGQRRFISVAVSVEEDLVSDAPDAEVPR
WVPDLQLLAGEAPGPDRTGLLLGNFVQEGSTVKRGLRLGPLLHLPRDGEPYRQAVAVLARIRAKAVYLAK
QTLTPVSDLESRLAQAEQRGKLMALMAALPGAEGVLRLPRLHPCDLYLALVTLSGPMALLCPGQVAPIPP
DYDHERPQAALDPLLRFLNEMAAEVSEAYRLSKFVLVDGVFELRLESTLEQELLVGVMSTSERAAIAWMS
GAVIGDQSEFSALRGRRVLGAAREPVGESGSMRYRNGYALFRIDAATLRSGGMLHIANPNEGALAERPSE
IVLFTQEDA
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|187476514|ref|NC_010645.1|:288651-289940 Bordetella avium 197N chromosome, complete genome
GTGGGGAAAAATGCGCAGGTCGTAGACCGGATCGCGTGGCATGAAGGGATGCTGCTCGCGCCACAGCATT
TCCAGCAACTGTCCGCCAGAGTGGATAGTCTGGTGGCTGCGCAGACCCTGGCTGCCCAGCCATTGGCTTG
GGGTTTGAGCCATTTAGTCCTGGATGAGCAGCTTTTGCCTGTGGGCAGGCTGAGGGTGCTGGAGCTGGAG
GCGGTGCTAGCGGATGGCACCTTGGTGTCGTACTCGGCGCTGGCAGGCACCCCGCTCGAGGTCGATCTGG
GCCCGTTTGAAAGCGCGATGCAGCAAGAGGGGGTTGATGTTTACCTCACGCTGGCGCTGGGACAACGACG
TTTCATTAGTGTTGCGGTCAGTGTCGAAGAAGACCTGGTTTCTGATGCACCAGACGCGGAAGTGCCGCGT
TGGGTGCCGGACTTGCAGCTATTGGCGGGCGAGGCACCCGGCCCCGATCGCACGGGTTTGCTGCTGGGGA
ACTTCGTTCAGGAGGGCAGCACCGTCAAGCGCGGCTTGCGTCTGGGTCCGCTGCTGCATCTGCCGCGCGA
TGGCGAGCCATACCGTCAGGCGGTAGCAGTCTTGGCGCGGATACGCGCCAAAGCCGTTTATTTGGCGAAA
CAGACGCTGACCCCCGTTTCTGATCTCGAAAGCCGTCTGGCTCAGGCGGAGCAGCGGGGCAAGCTGATGG
CCTTGATGGCCGCTCTGCCTGGTGCGGAAGGGGTGTTGCGTCTGCCTCGTCTTCATCCCTGCGATCTGTA
TCTGGCCCTGGTGACGCTATCGGGTCCGATGGCGCTGCTCTGCCCAGGACAGGTCGCGCCCATTCCGCCG
GATTATGACCATGAGCGACCGCAGGCCGCGCTAGATCCGCTGCTGCGTTTTCTCAATGAGATGGCTGCCG
AGGTCAGTGAGGCTTACCGGCTGAGCAAATTTGTGCTTGTAGACGGTGTGTTCGAGTTGCGCCTGGAAAG
CACCTTGGAACAGGAGTTGTTGGTGGGTGTGATGAGCACGTCCGAGCGGGCCGCGATTGCCTGGATGAGC
GGGGCCGTTATCGGTGATCAGTCAGAGTTCTCGGCATTGCGTGGACGACGGGTGCTCGGCGCCGCACGAG
AACCTGTCGGCGAGTCGGGCAGCATGAGGTATCGCAACGGCTACGCGTTATTCCGAATCGATGCCGCCAC
ATTGAGATCCGGAGGCATGCTCCATATTGCCAATCCTAATGAGGGGGCTTTAGCCGAGCGGCCTTCGGAA
ATCGTGCTGTTCACCCAGGAGGATGCATGA