SecReT6
Protein ID: 187476795
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0281
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]289937..290680 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ2L028
KEGG IDbav:BAV0281
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.90E-29, Aligned region: 28..223
Protein Sequence: 247 a.a.     [Download]
>gi|187476795|ref|YP_784819.1| unnamed protein product [Bordetella avium 197N]
MSFTRMPKEASATDVMLGQFVSYVELLLNLMRTAAEGEPACDAARRVNMQLIDALEIQTLEARRESSRFD
IENMADSRYLKAAVADELLLHTPWPGQACWGDYLLESALYRSNVAGDRIFELIEKILRDQEPAQRGLARL
LLYALALGYEGRFRGEGQEGRLREYRLELYEFSYQRRPDLDSLDRVIEPKAYAHLLSHFSPRRFVAVSRG
SLLFLIAVVGMLALSEIAWLWQSWPVRTELNHVESGN
 
Nucleotide Sequence: 744 bp     [Download]
>gi|187476514|ref|NC_010645.1|:289937-290680 Bordetella avium 197N chromosome, complete genome
ATGAGCTTCACGCGCATGCCCAAGGAAGCGTCCGCAACCGATGTCATGCTTGGGCAGTTTGTCAGCTATG
TCGAGCTGTTGTTGAACCTCATGCGCACCGCTGCCGAAGGTGAGCCGGCCTGCGATGCCGCGCGCCGCGT
CAACATGCAGTTAATCGACGCCCTTGAGATCCAGACCCTAGAAGCGCGACGGGAGAGTTCGCGCTTCGAT
ATTGAAAACATGGCTGACTCGCGCTATCTCAAGGCGGCGGTGGCAGACGAGTTGTTGCTGCATACGCCTT
GGCCGGGCCAGGCCTGCTGGGGGGATTATCTGTTGGAGTCCGCTTTGTACCGCAGCAATGTTGCGGGTGA
CCGGATTTTCGAGCTGATAGAGAAAATTCTGCGTGACCAGGAGCCGGCTCAGCGGGGATTGGCGCGCCTC
TTACTCTATGCCTTGGCCTTGGGCTATGAGGGCCGCTTTCGGGGGGAGGGGCAGGAAGGGCGTTTGCGTG
AATACCGCCTGGAGCTCTACGAGTTCTCCTACCAGCGCAGGCCGGATCTCGATAGTTTGGACCGCGTCAT
TGAGCCCAAGGCCTATGCGCATCTTTTGTCGCATTTTTCTCCGCGCCGGTTTGTCGCTGTCAGCCGCGGC
TCACTGCTTTTTCTGATTGCCGTGGTGGGGATGCTGGCGTTATCGGAAATCGCCTGGCTGTGGCAGTCGT
GGCCGGTTCGGACTGAATTAAACCATGTCGAATCAGGCAATTGA