SecReT6
Protein ID: 187476797
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0283
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]294475..295488 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ2L025
KEGG IDbav:BAV0283
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-22, Aligned region: 51..110
ImpA-rel_N [PF06812], Evalue: 2.80E-22, Aligned region: 221..239
Protein Sequence: 337 a.a.     [Download]
>gi|187476797|ref|YP_784821.1| unnamed protein product, partial [Bordetella avium 197N]
VIEHLLQAISGEPAGRSLRYDPITTRISAMRQEDDASLPQGEWQRELQRADWNGVAALCEEALVEHGKDF
QIAAWLCEAWARQRGLEGLCCGAQLLDGLIANFWEDGWPAIEDDDVEARRAPFVWLVATLPVVLLAHIPL
LDNRAQAWLTVDVFRRLTMRGAAQADEALQEGPDMAQVERLIAAQPQHGDVLRTALDQARLAWEALDRRL
NEHLGLEAPSFEPLREAFRQWEACLAALWPLKAISQPEPVVEVVAPSAEPETMSVPARIERPRDRAHAYQ
QIEMIAAYLAEIEPHSPTPYLLRQAASWGAMPLDVLMRSIAQEEGGLARLLSLLDVA
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|187476514|ref|NC_010645.1|:294475-295488 Bordetella avium 197N chromosome, complete genome
GTGATCGAACATCTTTTGCAGGCCATTTCTGGTGAACCTGCCGGACGATCCTTGCGCTATGACCCGATCA
CTACGCGCATCAGCGCCATGCGGCAGGAAGATGATGCCTCTCTGCCGCAAGGAGAGTGGCAGCGGGAGTT
GCAGCGGGCCGACTGGAATGGCGTTGCCGCGCTATGTGAAGAGGCGCTGGTCGAGCACGGCAAAGACTTT
CAGATCGCTGCCTGGCTATGCGAGGCATGGGCCAGGCAGCGGGGTCTGGAGGGGCTGTGTTGCGGGGCGC
AATTGCTGGACGGCCTGATCGCCAACTTTTGGGAAGATGGCTGGCCTGCCATCGAAGATGACGATGTGGA
GGCAAGGCGTGCGCCCTTTGTCTGGCTGGTGGCGACATTGCCCGTTGTCCTTTTGGCCCATATTCCTTTG
TTGGACAACCGCGCCCAGGCATGGCTGACGGTTGATGTTTTCCGCCGGCTGACGATGCGCGGTGCAGCAC
AGGCAGATGAGGCGCTGCAAGAAGGGCCCGATATGGCGCAGGTGGAGCGACTTATCGCGGCGCAACCGCA
ACACGGCGATGTGTTGCGCACGGCCTTAGACCAGGCGCGTCTGGCTTGGGAGGCGCTTGATCGGCGGTTG
AACGAGCATCTGGGATTGGAGGCGCCGAGTTTTGAGCCTCTGCGCGAGGCGTTTCGCCAATGGGAGGCCT
GCCTGGCGGCACTTTGGCCCCTCAAGGCGATATCGCAGCCTGAGCCAGTCGTTGAGGTGGTCGCGCCGTC
GGCGGAGCCCGAGACGATGTCAGTGCCGGCGCGCATCGAGCGTCCGCGCGATCGGGCGCATGCCTATCAG
CAGATTGAGATGATTGCCGCCTATCTGGCCGAGATAGAGCCGCATAGCCCGACGCCGTATTTGCTGCGGC
AGGCGGCTTCCTGGGGCGCAATGCCCTTGGATGTCTTGATGCGATCTATTGCGCAGGAAGAGGGCGGGCT
GGCGCGGCTGCTCTCCTTGTTGGACGTGGCTTAA