SecReT6
Protein ID: 187919612
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4909
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1034218..1035000 [-]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDB2TC53
KEGG IDbpy:Bphyt_4909
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.70E-57, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|187919612|ref|YP_001888643.1| type IV / VI secretion system protein, DotU family [Burkholderia phytofirmans PsJN]
MSYAPSLFGGSSTPTATPAPITEPTYQVRSLLDLLYDGFFMLFLLKNGREPGDAQEFSQRIQQFLGDFER
GAKKLNASADDVYASKFAFCAAIDESVLSSTFRIRTEWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARIGDEIAHMKGKRAPFAPHWPLPDQVAHRLKREVPLW
SIGAVFALVGLLAYLGLNTYLRDQTLRSLAPYSQVVKLGPQSATLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c1035000-1034218 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAGCTACGCGCCATCCCTCTTTGGCGGCAGCAGCACGCCTACCGCCACGCCCGCACCGATCACCGAGC
CGACCTATCAGGTTCGTTCGCTGCTCGATTTGCTGTACGACGGTTTCTTCATGCTGTTCCTGTTGAAGAA
CGGCCGTGAACCCGGCGACGCGCAGGAGTTCAGCCAGCGCATCCAGCAGTTCCTCGGCGACTTCGAACGC
GGCGCGAAGAAGCTCAATGCGTCGGCGGACGATGTCTATGCGTCGAAGTTTGCGTTCTGCGCGGCCATCG
ACGAATCGGTGCTGTCGTCCACCTTCAGGATCCGCACGGAATGGGAGCGCCGGCCGCTGCAACTGGTGCT
GTTCGGCGAGCAACTGGCGGGCGAGAAGTTTTTCCAGTATCTCGAGGAATGCCGCGCACAAGGCGCGGCG
CGTTTGCAATCGCTCGAGGTGTTTCACATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTGGAAG
GACCGGAGAAGCTCGCGTATCTGACCGCGCGCATCGGCGATGAAATCGCGCATATGAAAGGCAAGCGCGC
GCCGTTTGCGCCGCATTGGCCGTTGCCCGATCAGGTCGCGCACCGTCTGAAACGCGAGGTGCCGCTGTGG
TCGATCGGCGCGGTGTTCGCGCTGGTGGGATTGCTGGCTTATCTCGGCCTGAATACTTATCTGCGCGATC
AGACCTTGCGCTCGCTCGCGCCGTATTCGCAGGTGGTCAAGCTCGGGCCGCAATCGGCTACGTTGACGAT
TTCGTTGCCCTAA