SecReT6
Protein ID: 187919613
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4910
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1034997..1036343 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB2TC54
KEGG IDbpy:Bphyt_4910
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-132, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|187919613|ref|YP_001888644.1| type VI secretion protein [Burkholderia phytofirmans PsJN]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSARFDRDALGSNVLRVSELSLVFP
DGALYSAPQADDLPPPIALDTLPDGINEFTFYLALHPLRETGANYAQDSNAGFVSRYVSEQTPVADHFTD
AAEADITFLKTSVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDTFVPPCLAIDASPILHQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFASLAHLYQHSALHPERLFQELLRLAGQLMT
FSKGYALSDLPAYRHDDPGPGFARLDTILRDLLETVISTRYFAIALEEVRPSFHAGRLDSGKIDDKTMFY
IAVSADMPTAELVEAVPARFKVGAPDDVDKLVLSAMPGVRLVYTPQVPPAIPVRPGACYFSCESRGALYD
RMLQAQSAMIYAPSGINDLQLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c1036343-1034997 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAGTTATTCCGCAAAAGTGCTCTGGGGGGAAGGCCTGTTTTTGAGGCCGCAGCATTTTCAGCGTCAGG
ACGCTTATCATGAGGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTATAACTGGGGCGTGCGCTC
GGCGCGCTTCGACCGCGACGCGCTCGGCAGCAACGTGCTGCGCGTGAGCGAACTCTCACTGGTATTTCCC
GACGGCGCGCTCTACTCCGCGCCGCAGGCCGACGATCTGCCGCCGCCCATCGCGCTGGATACGCTGCCCG
ACGGCATCAACGAATTCACGTTTTATCTTGCGCTGCATCCGCTGCGCGAAACCGGCGCGAACTATGCACA
GGACAGCAACGCCGGTTTCGTGTCGCGTTACGTAAGCGAGCAGACTCCGGTGGCCGATCATTTCACCGAC
GCCGCCGAAGCCGACATCACCTTCCTGAAGACCAGCGTCAAGTTGATCGCGCATAGCGAGCCGCGCGATC
AACTGCTCTCGGTGCCGCTCGTGCGTGTACGCCGCACCGCTACGAGCGGTTTCGAAATCGACGATACGTT
CGTGCCGCCCTGCCTCGCAATCGACGCCTCGCCGATCCTGCATCAGCGCCTGCGCCAGCTGATCGACGCA
CTGCAGGCCAAGGTCAACGCGTTATACGGTTTTCACCGCGAGCCGACCAAGAACATCATCGAATTCCGTT
CCGGCGACATCGCGTCGTTCTGGCTTCTGCATACCGCGAGTGCGGCATTCGCGTCGCTCGCGCATCTGTA
CCAGCATTCGGCGCTGCATCCCGAACGCCTGTTCCAGGAACTGCTGCGCCTCGCCGGCCAGTTGATGACG
TTTTCGAAGGGCTACGCGCTGTCCGACTTGCCGGCTTACCGGCACGACGATCCGGGGCCCGGCTTCGCGC
GCCTCGACACGATCCTGCGCGATCTGCTCGAAACCGTGATCTCCACGCGCTACTTCGCGATCGCGCTCGA
GGAAGTGCGGCCGTCGTTCCATGCGGGCCGGCTCGACTCAGGCAAGATCGACGACAAAACCATGTTCTAC
ATCGCGGTGTCGGCTGATATGCCGACCGCCGAGCTCGTGGAAGCCGTGCCCGCGCGCTTCAAGGTCGGCG
CGCCGGACGACGTCGACAAGCTGGTGCTCTCGGCCATGCCGGGCGTGCGGCTCGTCTACACGCCGCAGGT
GCCGCCCGCCATTCCGGTCCGTCCGGGCGCGTGCTACTTCTCTTGCGAATCGCGTGGCGCGCTGTATGAC
CGTATGTTGCAGGCCCAATCGGCAATGATCTATGCGCCGTCGGGCATCAACGATCTTCAACTCGAACTGA
TCGCCGTCACATCATGA