SecReT6
Protein ID: 187919614
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4911
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1036452..1037084 [-]
Producttype VI secretion protein
NoteTssJ
UniProt IDB2TC55
KEGG IDbpy:Bphyt_4911
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-36, Aligned region: 21..182
Protein Sequence: 210 a.a.     [Download]
>gi|187919614|ref|YP_001888645.1| type VI secretion protein [Burkholderia phytofirmans PsJN]
MYMNSHVIRYASLLIANAAACLLLGGCAAGVTVLGAAANAALQASGLGKPDLPDAQKPPRNVGLTLYAAP
NLNAANDKRPLALVVRLYVLKDPTSFQQAPFDAFTDPAKEKTILGGDLLGVREVTLIPGQRYVVTEKVSR
EAQAFGIVALFRDPAMQRWKFAFDPAKSEKSGIMIGLHNCAMTVTNGTVIPPDQGLPAQALNMLSSVSCG
 
Nucleotide Sequence: 633 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c1037084-1036452 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGTATATGAATTCGCATGTTATTCGCTATGCATCGTTATTGATTGCCAATGCGGCCGCCTGCCTGCTGC
TGGGCGGCTGCGCAGCGGGCGTGACGGTGCTCGGAGCCGCTGCCAACGCGGCTTTGCAGGCAAGCGGCCT
CGGCAAACCGGACCTGCCGGATGCCCAGAAACCGCCGCGCAATGTCGGTCTCACCTTATATGCCGCACCG
AATCTGAATGCCGCGAATGACAAACGGCCATTGGCGCTGGTAGTACGGCTTTACGTGCTGAAAGACCCGA
CTTCATTCCAGCAGGCGCCATTCGACGCATTTACCGATCCGGCAAAGGAAAAGACCATACTGGGCGGTGA
TTTGCTGGGCGTGCGCGAAGTAACGCTGATCCCCGGCCAGCGCTACGTTGTTACCGAAAAAGTCTCGCGT
GAAGCGCAGGCATTCGGTATCGTCGCGCTATTCCGCGATCCGGCAATGCAGCGCTGGAAATTTGCCTTCG
ACCCGGCGAAGTCGGAGAAATCCGGCATAATGATCGGCCTGCATAACTGTGCAATGACGGTGACCAATGG
CACGGTGATCCCGCCAGACCAGGGACTGCCCGCGCAAGCGCTGAATATGCTTTCTTCGGTAAGCTGCGGA
TAA