SecReT6
Protein ID: 187919616
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4913
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1038159..1038707 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB2TC57
KEGG IDbpy:Bphyt_4913
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-58, Aligned region: 11..164
DASH_Spc34 [PF08657], Evalue: 0.0031, Aligned region: 84..171
Protein Sequence: 182 a.a.     [Download]
>gi|187919616|ref|YP_001888647.1| type VI secretion protein [Burkholderia phytofirmans PsJN]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSEAGGKFAVDLRFKSMADFNPDEVVAQIEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLNNTQQLQTLAKDQSNAADQHGGAPDHDKHGE
 
Nucleotide Sequence: 549 bp     [Download]
>gi|187918714|ref|NC_010676.1|:1038159-1038707 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGGCGAAGAAAGAAAGCATTCAGAAACGCTTGCAAAAAGTGCGGCCGCCCCGCGTTCAGTTGACCTATG
AGGTCGAGCGCGGCGATGCGATCGAGGTGAAGGAGCTGCCGTTCGTCGTGGGCGTGGTGGCCGATCTGGC
GGGGCAGTCAGAAGTCGAGCAGCCGAAGCTGCGCGATCGCAAGTTCGTCAATATCGACCGCGACAACTTC
GACGACGTGATGAAGGCAATCGAGCCGCGCGCCGCGTTTCAGGTGGAAAACCGCCTGAGCGAAGCCGGCG
GCAAATTCGCGGTCGACCTGCGCTTCAAGTCCATGGCCGATTTCAATCCGGACGAAGTGGTCGCGCAAAT
CGAACCGCTGCGGCGCCTGCTCGAAGCGCGTTCGAAGCTCGCTGATCTGCGCAACAAGCTGGCCGGCAAC
GACAAACTCGAAGACCTGCTGAGCGAAGTGCTCAACAACACGCAGCAGTTGCAAACCCTGGCGAAAGACC
AGAGCAACGCGGCGGACCAGCACGGCGGCGCGCCGGACCACGACAAGCACGGCGAATAA