SecReT6
Protein ID: 187919617
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4914
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1038722..1040212 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB2TC58
KEGG IDbpy:Bphyt_4914
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-189, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|187919617|ref|YP_001888648.1| EvpB family type VI secretion protein [Burkholderia phytofirmans PsJN]
MNQQTAAAQLATAQSGTESTLLDEIVEKSRVAKSDSEHARAKDLIGELVHQVLDGTVVVSDNLSATIDAR
VAELDRLISAQLSAVMHAPEFQRMESTWRGLDYLCKESNTGATVKIKALHAPKRDLVRDFKTAIEFDQSA
LFKKIYEEEFGTFGGSPFGTIVGDFEVTRQPEDMYFIEQMSHVAAAAHAPFIASASPELMGLDTFADLGK
PRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGATAEGFNFVEDVDGTDHSKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
EVFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|187918714|ref|NC_010676.1|:1038722-1040212 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAATCAGCAAACGGCAGCAGCTCAACTCGCGACCGCGCAAAGCGGTACGGAATCCACGCTGCTCGACG
AAATCGTCGAGAAAAGCCGCGTGGCTAAGTCCGATTCCGAGCACGCGCGCGCGAAAGACCTGATCGGCGA
ACTCGTGCATCAGGTGCTCGACGGCACGGTGGTGGTGTCCGACAACCTGTCGGCCACCATCGACGCACGC
GTCGCCGAACTCGACCGCCTGATCTCCGCGCAGTTGAGCGCGGTGATGCACGCGCCCGAATTCCAGCGCA
TGGAAAGCACGTGGCGCGGTCTGGACTATCTGTGCAAGGAAAGCAATACCGGCGCAACCGTCAAGATCAA
GGCGCTGCATGCGCCCAAGCGCGACCTGGTGCGCGACTTCAAGACCGCGATCGAATTCGATCAGAGCGCA
TTGTTCAAGAAGATCTACGAAGAAGAATTCGGCACCTTCGGCGGCTCGCCGTTCGGCACGATCGTCGGCG
ACTTCGAAGTGACGCGCCAGCCGGAAGACATGTACTTCATCGAGCAAATGTCGCACGTTGCCGCGGCCGC
GCATGCGCCGTTCATCGCGTCGGCTTCGCCCGAATTGATGGGCCTCGATACCTTTGCCGACCTCGGCAAG
CCGCGTGATCTCGGCAAGGTGTTCGACACGGTCGAATACGCCAAGTGGAAGTCGTTTCGCGACGCCGAAG
ATTCGCGCTATGTCGGTCTCACGCTGCCGCGCTTTCTCGGCCGCCTGCCGTTCAATCCGAAAGACGGCGC
CACGGCGGAGGGTTTCAACTTCGTCGAAGACGTGGACGGCACGGATCACAGCAAATACCTGTGGTGTAAC
GCGGCGTGGGCGTTCGCCGCACGCCTGACGGCCGCATTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTGGAAGGCGGCGGTCTGGTGGAAGATCTGCCCACCCACACTTTCAAGACCGACGACGGCGAAGTCGC
GCTGAAATGCCCGACTGAAATCGCGATCACCGACCGCCGCGAAAAGGAACTGAGCGACCTCGGTTTCATT
CCGCTCGTGCATTGCAAGAACTCCGACTACGCCGCGTTCTTCGCCGCGCAATCGGTGCAGAAACCCAAGA
AATACAGCACCGACAGCGCGAATGCCAATGCGGTCCTGTCCGCGCAATTGCAGTACATCTTCTCGGTATC
GCGCGTCGCGCACTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTTGCATCGGCACAGAACGTC
GAAGTATTCCTGAACCGTTGGATCTCGCAGTACGTGCTGCTGGACGACAACGCCACTCAGGAGCAGAAGG
CGCAGTTCCCGCTGCGCGAGGCATCGATTCAGGTCTCGGAGATTCCGGGCAAGCCTGGTGCGTATCGTTC
GGTCGCATTCCTGCGTCCGCACTTTCAACTGGACGAGCTGTCGATCTCTTTGCGGCTTGTCGCTGACCTG
CCGAAACCGGCTAATTCATAA