SecReT6
Protein ID: 187919619
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4916
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1040879..1041358 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB2TC60
KEGG IDbpy:Bphyt_4916
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-22, Aligned region: 29..137
Protein Sequence: 159 a.a.     [Download]
>gi|187919619|ref|YP_001888650.1| type VI secretion system lysozyme-like protein [Burkholderia phytofirmans PsJN]
MKRFEPSFLDKLFDDEPHLPASPAMRQLSLDELKSTVARDVEAILNTRIALTEHELAALPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVAVTLELNEQSTNALNFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARAKL
 
Nucleotide Sequence: 480 bp     [Download]
>gi|187918714|ref|NC_010676.1|:1040879-1041358 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAAACGCTTCGAACCCAGCTTTCTCGACAAGCTGTTCGACGACGAACCGCATCTGCCGGCATCTCCGG
CAATGCGGCAATTGTCATTGGATGAATTGAAGAGCACAGTCGCGCGCGACGTCGAGGCGATCCTGAATAC
GCGCATCGCGCTGACCGAGCACGAGCTGGCGGCGTTGCCGGAATGTCAGCGCTCGGTCCTCACGTACGGC
CTGAACGATTTCGCGGGTTTGAGTCTTGCGAGCCATTACGACCGCACGTTCATCTGCAAATCGATTCAAC
AGGCCATTGCGCGGCACGAGCCGCGTTTGCAGCAGGTGGCGGTCACGCTCGAATTGAACGAACAATCCAC
CAATGCGCTGAACTTCGCGATTCAGGCGCTGCTGGTGGTGCATCCGGCGGAAGAACCGGTGAGTTTCGAT
GCGATGTTGCAGCCGTCCACGTTGCAGTATTCAGTGACGCGCGCACGCGCGAAGTTGTAG