SecReT6
Protein ID: 187919620
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4917
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1041478..1043316 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB2TC61
KEGG IDbpy:Bphyt_4917
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.50E-215, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|187919620|ref|YP_001888651.1| type VI secretion protein [Burkholderia phytofirmans PsJN]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLAMSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQLGTSAALSHLTEPVLVERGTELKSRPIRGVQCRFRTAYDVTLAPIRI
SEAKYTSVAMAPSATVLPGNATAIISITFESTAAQLDLSALKVGKLRTHLHGEQSFIAALADCLFVNGMA
TYVEADRRGVWKQLRESPVVQAGFDEDDALIDYPAKSHPAYRLLTEYFAFPEKFNFADFDLAAMTRESGR
CQRLTLHVVLKEVRSDSHMARLLDSLAAHHFRLFCTPVVNLFEQHGEPIRISHQAISYPVIAEARRAFAY
EVYSIDSVKLVRQQAHEESVIEFRPFYSLHHGEAARAGHYWFARRNDWVAQKSPGYETEISIVDIDFEPA
APQTDTLSLDLTCTNRDLPAGLAVGLEGGDLFLEGGSLTGSISMLRRPTPSVRFERGRAAHWRLISHLAL
NHVSLANSGLSALKEMLVLYDLRRTAVSARHIDGLVGIEQHAAVQWLPGKPFATFVRGIEIRLTIDEEHF
VGTSLASFVRVIDTFFGLYVHLNSFVQLVVVSKRTGEEILRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|187918714|ref|NC_010676.1|:1041478-1043316 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAGTTATCATTTCTGCGGCGCTATTCGCGCGACTTCGCCG
AGCGCTATCCGAAGATCGCGGCGCGTCTGGCCATGTCCGGCGAGCATTGCGAAGACCCGCACGTCGAGCG
GATGATCGAATCGTTCGCGCTGCTCGGCGCGCGCATCAACAAGAAACTCGACGACGATTACCCCGAGTTT
ACCGAAGCGCTGCTGGAAGTGCTTTACCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAGT
TGGGCACCTCCGCCGCGCTGAGTCATCTGACCGAACCGGTTCTTGTCGAACGCGGCACTGAACTCAAATC
GCGGCCCATTCGCGGCGTGCAATGCCGTTTCCGTACCGCTTACGATGTGACGTTGGCGCCGATCCGCATT
TCCGAGGCGAAGTACACATCCGTGGCGATGGCGCCGAGTGCGACCGTATTGCCCGGCAATGCCACGGCAA
TCATATCGATCACCTTCGAATCGACGGCGGCGCAACTCGATCTATCGGCGCTGAAAGTCGGCAAACTGCG
CACACACTTGCACGGCGAGCAGTCGTTTATCGCGGCGTTGGCGGACTGTCTGTTCGTCAACGGCATGGCC
ACTTACGTGGAAGCCGACCGTCGCGGCGTGTGGAAACAACTGCGCGAATCTCCGGTCGTGCAAGCCGGTT
TCGACGAAGACGACGCGCTGATCGACTATCCGGCCAAATCGCATCCGGCATACCGGTTGCTGACCGAATA
CTTCGCGTTCCCCGAAAAATTCAACTTCGCCGACTTCGATCTGGCGGCGATGACTCGCGAGAGCGGCCGC
TGCCAGCGATTGACGCTGCATGTCGTGCTCAAGGAAGTGCGCAGCGATTCGCACATGGCGCGTCTGCTGG
ATTCATTGGCCGCGCATCATTTCCGCCTGTTTTGCACGCCGGTGGTGAATCTGTTCGAGCAGCACGGTGA
GCCGATCCGTATCAGCCATCAGGCAATTTCATATCCGGTGATCGCCGAAGCGCGCCGCGCGTTTGCCTAC
GAGGTCTATTCGATCGATTCGGTGAAACTCGTCAGGCAGCAGGCGCATGAAGAATCGGTGATCGAGTTCC
GGCCGTTCTATTCATTGCATCATGGCGAAGCAGCGCGCGCGGGACATTACTGGTTTGCGCGGCGCAACGA
CTGGGTTGCACAGAAAAGCCCCGGCTACGAGACTGAAATCTCTATCGTCGATATCGACTTCGAACCGGCC
GCGCCGCAAACGGATACCTTGAGTCTCGATCTCACCTGCACCAATCGCGATTTGCCGGCCGGTCTGGCGG
TAGGGCTCGAAGGGGGCGATCTGTTTCTCGAAGGCGGCTCGCTGACCGGCAGCATCTCGATGCTGCGCCG
GCCCACCCCGAGCGTGCGTTTCGAGCGCGGTCGCGCCGCGCATTGGCGATTGATTTCCCATCTGGCGTTG
AATCATGTGTCGCTTGCCAATAGCGGCCTGTCGGCGCTCAAGGAAATGCTCGTGCTCTACGACTTGCGGC
GAACGGCGGTGTCCGCGCGGCATATCGACGGACTGGTCGGCATCGAACAGCATGCCGCCGTGCAATGGCT
GCCGGGTAAACCGTTCGCCACTTTCGTGCGCGGTATCGAGATTCGTTTGACGATCGACGAAGAACATTTC
GTCGGCACGAGTCTCGCGTCGTTCGTGCGCGTGATCGATACGTTTTTTGGGCTGTACGTGCATTTGAACA
GCTTTGTGCAACTGGTCGTCGTGTCGAAGCGCACTGGCGAGGAGATCCTGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG