SecReT6
Protein ID: 187919621
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4918
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1043280..1044374 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB2TC62
KEGG IDbpy:Bphyt_4918
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.80E-94, Aligned region: 18..345
Protein Sequence: 364 a.a.     [Download]
>gi|187919621|ref|YP_001888652.1| type VI secretion protein [Burkholderia phytofirmans PsJN]
MQTAQRRIDPGVVEQLLDEPHRFEFFQAVRILEKWFAQQSPSQPGRPGEIVAQRIAFRNSLSMSFPPSEI
HGAQSYDDAGAALKEKSQRTAALEDGSLDKVDITPAFFGLLGGQGALPLHYTEQIIAREQIKRDRAAREF
FDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLALAGVADDDTRNSLQSGEGALFDEAIAGYALA
ARHRPVSAAYLQRTLSEYFKVRVRVEQFVGKWYDVPRDQLTLLGSVNATLGATALAGERVWQRDMRARLV
IGPLDKADYEAFLPGADRAVALERMLTLLAGVTLEYEVSLVLRREAVGPSLLSKGARLGWDAFLCTKDAD
RDRADARYELHVIH
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|187918714|ref|NC_010676.1|:1043280-1044374 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCAGCTTCTCGACGAGCCGCATCGCTTCG
AATTTTTTCAGGCGGTGCGGATTCTCGAGAAGTGGTTCGCGCAGCAATCGCCATCTCAACCCGGACGTCC
CGGCGAAATTGTCGCGCAGCGAATTGCTTTTCGCAATTCGCTGTCGATGTCGTTCCCGCCGAGCGAGATT
CACGGCGCGCAGTCTTATGACGACGCAGGTGCGGCGCTGAAGGAAAAGTCGCAACGCACGGCAGCGCTCG
AAGACGGTTCGCTGGACAAGGTGGATATCACGCCGGCCTTTTTTGGTTTGCTCGGCGGGCAGGGCGCATT
GCCGCTGCACTACACCGAGCAGATCATCGCGCGTGAACAGATCAAGCGCGATCGTGCCGCGCGCGAGTTC
TTCGACGTGTTTTCGAATCGCGCGACGGCGCTGTTCTACGCGGCGTGGAAGAAGTACCGTCTGCCGTTTC
ACTACGAACTGGATCGCGACGAACGTTACCTGCCGCTATTGCTCGCGCTCGCCGGCGTCGCCGACGACGA
CACGCGCAACAGCCTGCAAAGCGGCGAGGGCGCGCTATTCGACGAGGCGATTGCCGGCTACGCATTGGCC
GCGCGGCATCGGCCGGTATCGGCGGCGTATTTGCAACGCACGCTCTCGGAGTACTTCAAGGTGCGGGTGC
GCGTCGAGCAGTTCGTCGGCAAATGGTACGACGTGCCGCGCGATCAATTGACCTTGCTCGGCAGCGTCAA
CGCGACGCTCGGCGCGACTGCGCTGGCGGGCGAGCGCGTCTGGCAGCGCGACATGCGTGCGCGCCTCGTG
ATCGGACCGCTCGACAAGGCCGATTACGAAGCGTTTTTGCCCGGCGCCGATCGTGCGGTGGCGCTCGAAC
GCATGCTCACGCTGCTGGCCGGCGTTACGCTCGAATACGAGGTGTCGCTGGTGCTGCGCCGCGAAGCCGT
CGGACCGAGCTTATTGAGCAAGGGCGCGCGCCTGGGTTGGGACGCATTCCTGTGCACTAAAGACGCCGAC
CGTGACCGCGCGGATGCCCGCTACGAATTGCACGTGATTCACTGA