SecReT6
Protein ID: 187919622
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4919
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1044410..1047085 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDB2TC63
KEGG IDbpy:Bphyt_4919
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.30E-43, Aligned region: 232..324
AAA_2 [PF07724], Evalue: 1.30E-43, Aligned region: 621..789
AAA [PF00004], Evalue: 1.10E-18, Aligned region: 233..346
AAA [PF00004], Evalue: 1.10E-18, Aligned region: 626..743
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 233..253
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 322..363
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 625..746
ClpB_D2-small [PF10431], Evalue: 4.20E-12, Aligned region: 796..867
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 50..82
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 210..258
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 277..311
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 468..541
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 596..646
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 692..714
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 791..822
Clp_N [PF02861], Evalue: 4.70E-08, Aligned region: 28..74
Clp_N [PF02861], Evalue: 4.70E-08, Aligned region: 114..132
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 53..95
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 233..319
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 350..393
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 622..646
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 687..719
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 219..249
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 602..744
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 234..298
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 477..477
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 625..661
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 794..831
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 227..255
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 625..643
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 802..836
AAA_29 [PF13555], Evalue: 0.0003, Aligned region: 224..249
AAA_29 [PF13555], Evalue: 0.0003, Aligned region: 621..651
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 233..256
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 289..328
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 443..463
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 620..643
NACHT [PF05729], Evalue: 0.00044, Aligned region: 233..260
NACHT [PF05729], Evalue: 0.00044, Aligned region: 381..485
NACHT [PF05729], Evalue: 0.00044, Aligned region: 626..646
AAA_19 [PF13245], Evalue: 0.00046, Aligned region: 231..257
AAA_19 [PF13245], Evalue: 0.00046, Aligned region: 622..647
AAA_30 [PF13604], Evalue: 0.00065, Aligned region: 219..332
AAA_30 [PF13604], Evalue: 0.00065, Aligned region: 621..650
Zeta_toxin [PF06414], Evalue: 0.00077, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 0.00077, Aligned region: 616..665
AAA_14 [PF13173], Evalue: 0.00079, Aligned region: 234..366
AAA_14 [PF13173], Evalue: 0.00079, Aligned region: 624..706
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 233..254
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 624..657
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 212..247
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 285..370
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 623..664
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 696..720
MobB [PF03205], Evalue: 0.0056, Aligned region: 234..256
MobB [PF03205], Evalue: 0.0056, Aligned region: 624..657
DEAD [PF00270], Evalue: 0.0074, Aligned region: 219..396
DEAD [PF00270], Evalue: 0.0074, Aligned region: 626..649
RNA_helicase [PF00910], Evalue: 0.0079, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.0079, Aligned region: 626..647
RNA_helicase [PF00910], Evalue: 0.0079, Aligned region: 722..744
Protein Sequence: 891 a.a.     [Download]
>gi|187919622|ref|YP_001888653.1| type VI secretion ATPase, ClpV1 family [Burkholderia phytofirmans PsJN]
MSTSLNTLIAKLNPTCRQAALLAANNCLARGHYEVDLEHLLLPLLDEPASDVALVLRASRIDPHALRADL
ERELQRLKTGNTRTPVFSKHLIELLEQAWLIASLDSQIGRIRSGHLLLALLSAPDLAQFAERMSPLLRDV
RVTDLKHKFDELTAGSREVEHSNDTQSAGDSASDPVASAVAPGAPSKTPALDTYTSNLTQRAREGKIDPV
IGREGEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPAPLKGVALHVLDMGLLQAGAS
VKGEFENRLKNVIDEVKKSPHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYK
KYFEKDAALARRFQVVKIEEPSEALAAAMLRGMASLMEKHFNVRVLDDAITEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALAHSSTPATIDDTKKRLERIDAEIAALEREAASGALHDERLAELRGLREEDLKDLAAD
EARYDKERVLVTEIVGLRADIDAARVNSAGPEQADKAQQAREKLAARVAELHALQGGQPMVPLQVDAHVV
AEIVASWTGIPLGRMVKDEIQTVLNLQPLLAARVIGQDHALEAIAQRVRTASANLEDPNKPRGVFMFVGP
SGVGKTETALALADVLYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLL
DEVEKAHPEVLEMFFQVFDKGTMDDAEGREIDFRNTLIILTSNVGSQAVMQACLNKSAEELPDADELAET
LRLQLYKAFKPAFLGRMKVVPYYPISDDVLAEIIELKLDRIRRRIESNHKAVFEWDESLVDAVLARCTEV
DSGARNVDHILNGTLLPEVAQQVLERVANGAAIERIAVRASEAGEFDYTVV
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|187918714|ref|NC_010676.1|:1044410-1047085 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAGCACGTCCCTCAATACCCTGATCGCCAAACTGAATCCGACCTGCCGGCAGGCGGCTTTGCTGGCGG
CGAACAATTGTCTCGCGCGCGGTCACTACGAGGTCGACCTCGAGCATCTGCTGCTCCCGCTGCTGGACGA
ACCGGCCAGCGACGTCGCACTGGTGCTGCGCGCGAGCAGGATCGACCCGCACGCCTTGCGCGCGGATCTC
GAGCGCGAGTTGCAGCGTTTGAAAACCGGCAATACGCGTACGCCGGTGTTTTCGAAGCATCTGATCGAGT
TGCTCGAACAGGCGTGGTTGATTGCATCGCTTGATTCGCAGATTGGGCGGATTCGCTCAGGGCATCTGCT
ACTGGCGCTTTTGAGCGCACCGGATCTCGCGCAATTCGCCGAGCGCATGTCGCCGCTGCTGCGCGACGTG
CGTGTGACCGACCTGAAGCACAAATTCGATGAGCTGACTGCGGGTTCGCGCGAAGTCGAGCACAGCAATG
ACACGCAAAGCGCGGGAGATAGCGCGAGTGATCCGGTGGCGAGCGCTGTCGCGCCGGGCGCGCCGTCTAA
AACGCCCGCGCTCGATACCTACACCAGCAACCTCACGCAGCGTGCGCGGGAAGGCAAGATCGATCCGGTG
ATCGGCCGCGAAGGCGAGATTCGCCAGGCCATCGATATTCTGATGCGGCGCCGCCAGAACAATCCGATCA
TGACGGGCGAAGCGGGCGTCGGTAAAACGGCCGTGGTCGAAGGTCTCGCGCTGCGCATTGCCGCCGACGA
TGTGCCCGCGCCGCTCAAAGGCGTCGCGCTGCACGTGCTCGACATGGGGTTGCTGCAAGCCGGCGCGAGC
GTGAAAGGCGAGTTCGAAAACCGCCTGAAGAATGTGATCGATGAGGTCAAGAAGAGTCCGCATCCAATCA
TTCTCTTTATCGACGAAGCGCACACCATCATCGGCGCCGGTGGTCAGGCCGGGCAGAACGATGCGGCCAA
TCTGCTGAAGCCGGCCTTGGCGCGCGGCGAATTGCGCACCATCGCGGCCACCACGTGGAGCGAGTACAAG
AAGTACTTCGAGAAAGACGCGGCGCTCGCGCGGCGTTTCCAGGTCGTGAAGATCGAGGAGCCTAGCGAGG
CGCTCGCCGCGGCTATGTTGCGCGGCATGGCTTCGCTGATGGAAAAGCATTTCAATGTGCGCGTGCTGGA
TGATGCGATCACAGAAGCCGTGCGTCTGTCGCATCGCTACATCAGCGGCCGGCAACTGCCGGATAAAGCG
ATCAGCGTGCTCGACACCGCTTGCGCGAAAGTCGCGCTCGCGCACAGTTCGACACCGGCGACCATCGACG
ACACGAAAAAACGCCTCGAACGTATCGACGCTGAAATCGCCGCGCTGGAACGCGAAGCGGCGAGCGGCGC
GCTGCACGATGAACGCCTCGCTGAATTGCGCGGCCTGCGTGAAGAGGACCTCAAAGACCTCGCCGCAGAC
GAAGCGCGCTACGACAAGGAACGCGTATTGGTGACGGAGATAGTCGGCTTGCGCGCTGACATCGACGCGG
CGCGCGTGAACAGCGCGGGCCCGGAGCAGGCGGATAAGGCACAGCAGGCGCGCGAAAAGCTTGCCGCGCG
CGTCGCCGAATTGCACGCCTTGCAAGGCGGCCAACCGATGGTGCCGCTGCAGGTCGACGCTCATGTGGTC
GCCGAAATCGTCGCCTCGTGGACCGGCATTCCGCTCGGCCGCATGGTCAAGGACGAAATCCAGACCGTGC
TGAACCTGCAGCCGTTGCTGGCCGCGCGTGTGATCGGTCAGGACCATGCGCTCGAAGCGATCGCGCAGCG
CGTGCGCACCGCTAGTGCGAATCTTGAAGACCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGACCG
TCGGGCGTCGGCAAGACCGAAACCGCGCTTGCGCTGGCCGATGTGCTGTACGGCGGCGAACGCAAGATGG
TCACGATCAACATGAGCGAGTATCAGGAAGCGCACAGCGTGTCCGGCCTGAAGGGTTCCCCGCCGGGCTA
TGTCGGTTACGGCGAGGGCGGTGTGCTGACCGAAGCGGTGCGCCGCAATCCGTATTCGGTGGTGCTGCTC
GACGAAGTCGAAAAGGCGCACCCCGAAGTGCTCGAAATGTTCTTCCAGGTGTTCGACAAAGGCACGATGG
ACGACGCCGAAGGCCGCGAGATCGATTTCCGCAACACGTTGATCATTCTGACTTCGAATGTCGGCTCGCA
GGCGGTGATGCAGGCGTGCCTGAACAAGAGCGCGGAAGAACTGCCCGACGCCGATGAACTCGCGGAAACC
TTGCGTCTGCAGTTATACAAAGCATTCAAACCGGCATTTCTCGGCCGCATGAAAGTGGTGCCGTACTATC
CGATTTCCGACGACGTACTGGCCGAGATCATCGAATTGAAACTCGACCGGATTCGCCGCCGCATCGAGTC
GAATCACAAGGCAGTGTTCGAGTGGGACGAGTCGCTGGTCGATGCGGTGCTCGCGCGTTGCACCGAGGTG
GATTCCGGCGCACGCAATGTGGATCACATTCTGAACGGCACGCTCCTGCCCGAAGTCGCGCAGCAGGTGC
TGGAACGTGTGGCGAACGGCGCCGCGATCGAGCGCATTGCCGTGCGCGCGAGCGAGGCGGGTGAGTTCGA
CTACACGGTGGTGTGA