SecReT6
Protein ID: 187919623
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4920
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1047140..1048249 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDB2TC64
KEGG IDbpy:Bphyt_4920
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-24, Aligned region: 55..116
Protein Sequence: 369 a.a.     [Download]
>gi|187919623|ref|YP_001888654.1| type VI secretion-associated protein, ImpA family [Burkholderia phytofirmans PsJN]
MPINLDILLAPLSETSPCGEDLLFSADFDAIQHARRFEDPSLDQGEWVTEIKEADWAFVVERSGSLLQTQ
TKDLRLAVWLTEALAIDEGINGLSQGYALLTGLCERYWDHVHPLPEGDDTEYRLGNVAWLVGRTGDLLRA
MPLTSSQGNAYSTIDWDVATHVAQAVKRDPDHADDIARGKPSIDQIEASKRATPPAFYSALLVDLKAFEA
AMLALEQELDRRAADSAPSFRQAKDAYQNVYRLAERFAREVGVNAEVPPPAKAPAANEHDRAEPTFKTAP
QREEPVLTTMPTSPIAGIQSRAQAVAQLRAVAKFFRATEPHNPAAYFADKAAEAADMPLHQWLSTVVKDD
GSLAHIRELLGVKPEENSE
 
Nucleotide Sequence: 1110 bp     [Download]
>gi|187918714|ref|NC_010676.1|:1047140-1048249 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGCCGATTAATCTAGACATCTTGCTGGCTCCGCTCAGCGAAACCTCGCCCTGTGGCGAAGATCTGCTGT
TCTCAGCCGATTTCGATGCGATCCAGCACGCGCGCCGTTTCGAAGACCCGTCGCTGGATCAGGGCGAATG
GGTCACGGAGATCAAGGAGGCGGATTGGGCGTTCGTGGTCGAGCGTTCGGGCAGCTTGCTGCAAACGCAG
ACCAAAGATTTGCGTCTCGCCGTCTGGCTCACTGAAGCGCTCGCGATCGATGAAGGCATCAACGGTCTTT
CGCAGGGTTACGCGCTCTTGACGGGGCTTTGCGAGCGCTACTGGGATCACGTGCATCCGCTGCCGGAAGG
CGACGACACCGAATATCGCCTCGGCAACGTCGCGTGGCTGGTCGGGCGTACGGGCGATCTGCTGCGCGCC
ATGCCGCTCACGTCGTCGCAAGGTAATGCGTACAGCACCATCGATTGGGACGTGGCCACGCACGTCGCGC
AAGCCGTCAAACGCGATCCGGATCACGCCGACGATATCGCGCGCGGCAAGCCGTCGATCGATCAGATCGA
GGCGTCGAAGCGCGCTACGCCGCCGGCATTCTATTCAGCGCTACTGGTCGATCTGAAAGCGTTCGAAGCG
GCCATGCTCGCGCTCGAACAGGAACTGGACCGGCGCGCCGCGGATTCCGCGCCGAGTTTCCGGCAAGCGA
AGGACGCTTACCAAAACGTGTACCGGTTGGCCGAGCGCTTTGCACGTGAAGTCGGCGTGAACGCCGAAGT
GCCGCCGCCCGCTAAAGCGCCCGCGGCGAACGAGCACGATCGCGCCGAGCCCACCTTCAAGACCGCACCG
CAACGCGAGGAACCTGTGTTGACGACCATGCCGACGAGTCCAATTGCAGGAATCCAGAGCCGCGCGCAGG
CCGTTGCGCAGTTGCGCGCGGTGGCCAAGTTCTTTCGCGCGACGGAGCCGCATAACCCTGCCGCGTATTT
CGCCGACAAGGCTGCGGAGGCCGCGGATATGCCATTGCATCAATGGCTTTCGACGGTGGTGAAAGACGAT
GGATCGCTCGCGCATATTCGCGAGTTGCTGGGCGTGAAGCCGGAAGAGAACAGCGAATAA