SecReT6
Protein ID: 187922936
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0935
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1052341..1053585 [-]
Producthypothetical protein
NoteTssL
UniProt IDB2T0Q2
KEGG IDbpy:Bphyt_0935
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.80E-62, Aligned region: 42..250
OmpA [PF00691], Evalue: 3.60E-15, Aligned region: 309..406
Protein Sequence: 414 a.a.     [Download]
>gi|187922936|ref|YP_001894578.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MEKKTGDSASGAKPELPATLLASIPAGEPQAARLQAVEDATNPLLEAARPLLRALADMPDNLDLTAIDQL
HLLLKQEVRTFQRLCEQANIRRDHMIGARYCLATALDEAAGKTVWGQRETGVEWLRKGLATEFHEDRQGG
DKVYLLIGRLMNEPREHLDLLEVIYRILSLGFMGRYRHEADGARKHDAVRQRLYNEIQTQRGVVPIALSP
RVQSDSRGQRLSVYDFPVRITFAVLGLILLGLFGWFKYHLLNHGASVEKQITDIGHLTPPAPRLPHLKEL
LKNEIAAGTVSVDEDARHSSVTFRGDAMFPPGGVNVNASMGPLIAKIASEIGKVPGKVTVTGHTDNLPIR
SRQFASNDALSEERATQVMQMLQASGVAAARLEAIGGGEANPIGDNATAQGRAQNRRVEITVTP
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|187922035|ref|NC_010681.1|:c1053585-1052341 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGGAGAAAAAAACCGGCGACTCGGCGTCCGGCGCGAAGCCCGAACTGCCGGCCACGTTGCTCGCGAGCA
TCCCCGCCGGTGAACCGCAAGCCGCCCGCCTGCAGGCCGTGGAGGACGCGACCAATCCGCTGCTGGAGGC
CGCGCGCCCTTTGCTGCGCGCGCTCGCCGACATGCCGGACAATCTGGATCTGACGGCCATCGATCAGCTT
CACCTGCTGCTCAAACAGGAGGTGCGCACCTTCCAGCGACTGTGCGAGCAAGCGAATATCAGGCGCGATC
ACATGATCGGCGCGCGTTACTGTCTGGCCACGGCGCTCGATGAGGCCGCCGGAAAGACCGTTTGGGGTCA
ACGCGAAACCGGCGTCGAATGGCTTCGCAAAGGCTTGGCCACCGAATTCCACGAGGACCGCCAAGGCGGC
GACAAGGTCTATCTGCTGATCGGACGGCTGATGAACGAGCCGCGCGAGCATCTCGACCTGCTCGAAGTGA
TCTATCGGATCCTGAGCCTCGGCTTCATGGGCCGTTACCGCCATGAAGCCGACGGCGCCCGCAAGCATGA
CGCCGTGCGTCAACGGCTCTACAACGAGATCCAGACGCAGCGCGGCGTCGTGCCGATCGCGCTGTCGCCG
CGAGTGCAATCCGACTCCCGCGGACAGCGTCTGTCGGTCTACGACTTTCCGGTCCGGATCACGTTTGCCG
TTCTCGGGCTGATCCTGCTCGGCCTGTTCGGCTGGTTCAAATACCATCTGCTCAACCATGGCGCGAGCGT
CGAGAAGCAGATCACCGATATCGGCCATCTGACGCCGCCGGCCCCACGCCTGCCCCACCTCAAGGAACTG
CTGAAGAACGAGATTGCGGCCGGCACGGTCAGTGTCGACGAAGACGCCCGTCATAGCTCCGTGACATTCC
GCGGCGACGCAATGTTCCCGCCGGGTGGCGTCAACGTCAACGCGTCGATGGGGCCGCTGATCGCGAAGAT
CGCGAGCGAAATCGGCAAGGTGCCCGGCAAGGTCACCGTCACCGGCCACACCGACAACCTGCCGATCAGA
AGCCGCCAGTTCGCATCGAACGATGCGCTCTCCGAAGAGCGCGCAACCCAGGTCATGCAGATGCTGCAAG
CATCGGGCGTGGCGGCGGCGCGGCTCGAGGCGATCGGCGGCGGCGAGGCGAATCCGATTGGCGACAACGC
AACGGCGCAAGGCCGCGCGCAGAACCGCCGCGTAGAAATTACGGTCACCCCCTGA