SecReT6
Protein ID: 187922937
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0936
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1053731..1055074 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB2T0M2
KEGG IDbpy:Bphyt_0936
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-148, Aligned region: 20..447
Protein Sequence: 447 a.a.     [Download]
>gi|187922937|ref|YP_001894579.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MSWYNKVTWSEGLFLRPQLFQQQERYLEHFAHKRAAPLSPFFFGFSHYAIDNEALALGKVILKSASGVFA
DGTPFDSPGNTPPPAPLTVRAEHLDQVIHLAVSIRVPNAEETTFDESSHSLARYAVFDTDLRDTNSVGQG
PKAVQLSNLRLRLVPQKEMTDAWIGLPLTRVKTLRADGSIELDDTLVPPVSGYGANALLTSWLAKVHDLT
RLRADALAKRLTGSDGQAGTVAEVSDYLLLQTLNRYEPLLQHLRRVPTTSPADLYALLLSMAGELSTYVR
PQTRRPLESHPPYQHIEPHLCLKPVVDDTHWLLNAVLVRSAQSIPFTDAGYGMRNAVVDPAEIRSFSSLV
LAVSAQMPPDTLVQQFAMQAKMGPSERLPDLVRSHLPGIALQALPVPPRQIPFNAGYVYYELSRTGPLWE
TVAQHGGIALHVAGDFPALRLELWGVR
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|187922035|ref|NC_010681.1|:c1055074-1053731 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGAGTTGGTATAACAAGGTCACCTGGAGCGAAGGTCTGTTCCTGCGCCCGCAGCTTTTCCAGCAGCAGG
AACGCTACCTCGAACATTTCGCCCATAAGCGCGCGGCGCCGCTTTCGCCCTTTTTCTTCGGCTTCTCTCA
CTACGCAATCGACAATGAGGCGCTCGCGCTCGGCAAAGTGATCCTGAAGTCTGCCAGCGGCGTATTCGCC
GACGGCACGCCCTTCGATTCGCCGGGGAACACGCCGCCGCCCGCCCCGCTGACGGTACGCGCGGAGCATC
TGGACCAGGTCATCCATCTTGCCGTGTCCATTCGCGTGCCCAACGCGGAAGAAACGACCTTCGACGAGTC
CTCCCATTCGCTCGCCCGCTATGCCGTGTTCGACACGGACTTGCGCGATACGAACTCGGTCGGACAAGGT
CCGAAAGCCGTTCAACTATCCAACCTGCGGCTGCGACTAGTGCCGCAGAAGGAGATGACCGACGCGTGGA
TCGGTCTACCCTTGACGCGAGTCAAGACGCTTCGTGCGGACGGCAGCATCGAACTCGACGATACCCTGGT
CCCGCCGGTGTCGGGCTATGGCGCCAACGCGTTGCTCACGAGCTGGCTGGCGAAGGTCCACGACCTCACG
CGCCTGCGTGCGGATGCGCTCGCCAAACGGCTGACCGGGAGCGACGGCCAGGCCGGCACGGTCGCGGAGG
TCTCGGACTATCTGCTGCTGCAAACGCTCAATCGCTACGAACCGCTGTTGCAACACCTACGCCGGGTTCC
GACCACCTCCCCCGCCGATCTCTACGCGCTGCTGCTCAGCATGGCTGGAGAACTCTCGACCTACGTGCGT
CCGCAGACGCGCCGGCCGCTCGAAAGCCATCCGCCGTATCAGCACATCGAGCCGCATCTGTGCCTGAAGC
CCGTGGTCGACGACACACACTGGCTGCTCAACGCGGTCCTCGTACGCAGCGCGCAAAGCATTCCGTTTAC
CGACGCGGGATACGGCATGCGCAACGCAGTGGTCGATCCGGCGGAAATTCGCAGTTTCAGTTCGCTGGTC
CTCGCCGTGTCGGCTCAGATGCCGCCGGACACGCTGGTCCAGCAATTCGCCATGCAGGCCAAGATGGGAC
CGTCCGAACGTCTGCCGGATCTGGTGCGCTCGCATCTGCCAGGCATCGCGCTTCAGGCGCTGCCCGTGCC
GCCGCGGCAGATTCCATTCAACGCCGGCTACGTGTACTACGAACTCTCGCGTACGGGTCCGCTGTGGGAG
ACCGTCGCGCAGCACGGCGGCATTGCGCTGCATGTGGCGGGTGATTTCCCCGCACTCAGGCTGGAACTGT
GGGGCGTGCGCTGA