SecReT6
Protein ID: 187922938
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0937
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1055087..1055599 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDB2T0M3
KEGG IDbpy:Bphyt_0937
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.30E-43, Aligned region: 14..160
Protein Sequence: 170 a.a.     [Download]
>gi|187922938|ref|YP_001894580.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MRPSTHVVALICVLGLTACASNDPKAVHEPVRLDLSITASSSVNPDDQKRAAPIVVRIYELKNADAFTAA
DFFSLQDKDKTVLADDLVVREQYQLRPGESRTIRRNADQATTTLGVIAAYRDLPNSVWRATWTLPSSPPA
AWYRIAPKLKLTINLDTSAIRITDAQKQNK
 
Nucleotide Sequence: 513 bp     [Download]
>gi|187922035|ref|NC_010681.1|:c1055599-1055087 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGCGCCCGTCCACTCACGTCGTCGCACTTATCTGCGTACTCGGACTTACCGCATGCGCGAGCAACGATC
CCAAAGCCGTTCATGAACCCGTGAGGCTCGACCTGTCGATAACCGCCTCATCGAGCGTCAATCCCGACGA
CCAGAAACGCGCCGCGCCGATCGTGGTGCGCATTTACGAATTGAAAAACGCCGACGCGTTCACTGCCGCC
GACTTCTTCTCGCTGCAGGACAAGGACAAGACCGTGCTCGCCGACGACCTTGTCGTGCGCGAGCAGTATC
AGCTTCGTCCAGGAGAAAGCCGGACTATTCGGCGCAACGCCGATCAGGCCACGACCACTCTCGGTGTCAT
CGCGGCCTACCGCGATCTGCCGAATTCCGTGTGGCGCGCCACCTGGACACTGCCGTCATCGCCACCGGCT
GCGTGGTACCGGATCGCGCCGAAACTGAAGCTGACGATCAATCTCGATACCAGTGCGATCCGGATCACCG
ACGCACAAAAACAAAACAAGTAA