SecReT6
Protein ID: 187922941
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0940
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1056906..1058405 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDB2T102
KEGG IDbpy:Bphyt_0940
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-194, Aligned region: 66..493
Protein Sequence: 499 a.a.     [Download]
>gi|187922941|ref|YP_001894583.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MTTQQVKATASATAAHSQTDFSQLLAQEFRPKTAAARDAVEYAVQTLAEQALQQSIIISDDAYKSIEAII
AQIDHKLSEQINLILHHNDFQKLESAWRGLHHLVSNTETDERLKIRFMDVSKEELRRTMKRYKGLAWDQS
PLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSIAKISAAAHTPFISGASPSVLQMESWQELA
NPRDLTKIFAQNLEYAPWNSLRNTEDARYIGLAMPRFLSRLPYGAQTNPVDEFDFEEDTNGPDHRNYAWA
NAAYAMGVNINRSFKLYGWCSLIRGVESGGTVESLPCHTFPTDDGGIDMKCPTEIAISDRREAELSKNGF
IPLVHRKNTDHATFIGAQSVQKPAEYHDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGTFRERED
MQRWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
RLPSVKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|187922035|ref|NC_010681.1|:c1058405-1056906 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGACAACACAGCAGGTAAAGGCAACGGCAAGCGCAACTGCCGCGCATTCACAGACCGACTTTTCGCAGT
TGCTCGCGCAGGAATTTCGCCCCAAGACCGCCGCGGCTCGGGACGCCGTCGAATATGCGGTTCAAACGCT
GGCCGAGCAGGCGCTGCAGCAGTCGATCATCATCAGCGACGACGCGTACAAGAGCATTGAAGCGATCATC
GCGCAAATCGATCACAAGCTGTCGGAGCAGATCAACCTGATCCTCCACCACAACGATTTCCAGAAACTGG
AATCGGCGTGGCGCGGTCTGCATCATCTGGTGTCGAACACCGAAACGGACGAGCGGCTGAAGATCCGCTT
CATGGACGTTTCGAAGGAGGAACTGCGTCGCACGATGAAGCGCTACAAGGGCCTCGCATGGGATCAGAGT
CCGCTCTTCAAGCAGATTTACGAAGAGGAATATGGCCAGCTCGGCGGCGAACCGTACGGCTGCCTTGTTG
CTGACTATTACTTCGACCACACACCGCCCGACGTCGACCTGCTCGGCTCGATTGCCAAAATCTCCGCAGC
CGCGCATACGCCGTTCATCTCGGGGGCCTCGCCCTCGGTGCTGCAGATGGAGTCGTGGCAGGAACTCGCC
AACCCGCGCGATCTGACGAAAATCTTCGCGCAAAATCTCGAGTACGCGCCGTGGAATTCCCTGCGCAATA
CGGAAGATGCGCGCTATATCGGGCTCGCAATGCCGCGCTTCCTGTCGCGTCTGCCGTATGGCGCTCAGAC
GAACCCGGTCGATGAATTCGATTTCGAGGAAGACACCAACGGTCCAGATCACCGCAACTATGCGTGGGCC
AATGCCGCGTACGCCATGGGCGTGAACATCAACCGGTCGTTCAAGCTGTATGGCTGGTGCTCGCTGATTC
GCGGCGTCGAGTCGGGCGGCACGGTCGAGAGCTTGCCGTGCCACACGTTCCCGACCGATGACGGCGGCAT
CGACATGAAGTGCCCGACGGAAATCGCAATCTCGGACCGTCGCGAAGCCGAACTGTCGAAGAACGGTTTT
ATTCCGCTCGTGCACCGTAAAAACACCGACCACGCGACCTTCATCGGTGCCCAATCGGTGCAGAAGCCCG
CCGAATACCACGATCCGGATGCGACTGCCAACGCCAACCTGTCGGCGCGTCTACCGTATCTGTTCGCCTG
CTCGCGATTCGCGCACTACCTGAAGTGCATTGTGCGCGACAAGATCGGGACGTTCCGCGAGCGCGAGGAT
ATGCAGCGCTGGCTCAACGAATGGATCATGAACTACGTCGACGCGGACCCGGCGAATTCATCGCAGGAAA
CCAAAGCACGCCGCCCGCTGGCGGCAGCCGAAGTGGTCGTCGAGGATGTCGAAGGCAACCCCGGCTACTA
CCAGGCGAAGTTCTTCCTGCGCCCGCACTTCCAGCTCGAAGGCCTCACGGTGTCGCTGCGTCTTGTTGCG
CGGCTGCCTTCCGTGAAGGAAGCGGCCTGA