SecReT6
Protein ID: 187922942
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0941
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1058476..1059021 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB2T103
KEGG IDbpy:Bphyt_0941
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.10E-59, Aligned region: 11..161
Protein Sequence: 181 a.a.     [Download]
>gi|187922942|ref|YP_001894584.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MSVSNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPVEPLPAVADRRFLDIDIDNF
DERMKALKPRVAFAVPNTLTGEGQLMVDMTFESMEDFSPAAVASKVQPLHRLLDARTQLANLQTYMDGKS
GAEALVNKLLADPALLKALTAVPKPKVIDETEHNHTDKASN
 
Nucleotide Sequence: 546 bp     [Download]
>gi|187922035|ref|NC_010681.1|:c1059021-1058476 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGTCCGTTTCAAACAGTTCGCAGAAGTTCATCGCGCGCAACCGTGCGCCGCGCGTCCAGATCGAGTACG
ACGTCGAGATCTACGGTTCCGAGAAAAAGGTAGAACTGCCATTCGTGATGGGCGTGCTTGCCGATCTATC
CGGCAAGCCGGTCGAACCGCTGCCGGCTGTCGCCGACCGCCGCTTCCTCGACATCGATATCGACAACTTC
GACGAGCGCATGAAAGCGCTCAAGCCACGCGTCGCATTCGCGGTGCCCAATACGCTCACGGGCGAGGGCC
AATTAATGGTCGACATGACATTCGAAAGCATGGAGGACTTCTCGCCGGCCGCCGTCGCCAGCAAGGTCCA
GCCCTTGCATCGCCTGCTCGACGCGCGTACGCAACTGGCCAATCTGCAAACCTATATGGACGGCAAGTCC
GGCGCCGAAGCGCTCGTCAACAAGCTGCTGGCTGATCCAGCCTTGCTGAAGGCGCTCACCGCCGTGCCGA
AGCCGAAGGTTATCGACGAGACAGAACACAACCATACCGACAAGGCGTCGAACTGA