SecReT6
Protein ID: 187922943
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0942
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1059058..1061778 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDB2T104
KEGG IDbpy:Bphyt_0942
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.20E-39, Aligned region: 230..310
AAA_2 [PF07724], Evalue: 4.20E-39, Aligned region: 615..781
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 232..363
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 620..703
ClpB_D2-small [PF10431], Evalue: 2.40E-14, Aligned region: 789..858
AAA_5 [PF07728], Evalue: 5.00E-14, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 5.00E-14, Aligned region: 336..362
AAA_5 [PF07728], Evalue: 5.00E-14, Aligned region: 619..737
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 32..77
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 210..249
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 273..311
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 477..531
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 609..662
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 684..707
Sigma54_activat [PF00158], Evalue: 1.10E-07, Aligned region: 227..253
Sigma54_activat [PF00158], Evalue: 1.10E-07, Aligned region: 618..718
AAA_19 [PF13245], Evalue: 5.50E-07, Aligned region: 230..255
AAA_19 [PF13245], Evalue: 5.50E-07, Aligned region: 617..641
AAA_22 [PF13401], Evalue: 7.10E-07, Aligned region: 232..313
AAA_22 [PF13401], Evalue: 7.10E-07, Aligned region: 365..400
AAA_22 [PF13401], Evalue: 7.10E-07, Aligned region: 617..642
AAA_22 [PF13401], Evalue: 7.10E-07, Aligned region: 681..705
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 227..256
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 477..512
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 617..646
IstB_IS21 [PF01695], Evalue: 5.00E-06, Aligned region: 213..296
IstB_IS21 [PF01695], Evalue: 5.00E-06, Aligned region: 619..639
IstB_IS21 [PF01695], Evalue: 5.00E-06, Aligned region: 691..717
AAA_29 [PF13555], Evalue: 4.50E-05, Aligned region: 224..250
AAA_29 [PF13555], Evalue: 4.50E-05, Aligned region: 617..644
NACHT [PF05729], Evalue: 4.60E-05, Aligned region: 232..259
NACHT [PF05729], Evalue: 4.60E-05, Aligned region: 293..333
NACHT [PF05729], Evalue: 4.60E-05, Aligned region: 619..646
AAA_17 [PF13207], Evalue: 9.70E-05, Aligned region: 232..249
AAA_17 [PF13207], Evalue: 9.70E-05, Aligned region: 619..657
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 618..659
AAA_18 [PF13238], Evalue: 0.0003, Aligned region: 232..251
AAA_18 [PF13238], Evalue: 0.0003, Aligned region: 620..651
AAA_14 [PF13173], Evalue: 0.00035, Aligned region: 232..312
AAA_14 [PF13173], Evalue: 0.00035, Aligned region: 618..706
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 211..245
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 285..315
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 618..660
T2SE [PF00437], Evalue: 0.0044, Aligned region: 222..249
T2SE [PF00437], Evalue: 0.0044, Aligned region: 615..689
AAA_30 [PF13604], Evalue: 0.009, Aligned region: 231..254
AAA_30 [PF13604], Evalue: 0.009, Aligned region: 618..649
Protein Sequence: 906 a.a.     [Download]
>gi|187922943|ref|YP_001894585.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MTISRQALFGKLGATLFRSIESATAFCKLRGNPYVELVHWLHQLLQLPDSDMHRIARHAGIERTTLERDL
ARALAALPAGASSISDISHHIELAVERAWVLATLDFGDRRIRGAWLLAALLGTPELRRVLLSASPAFARI
PVDTPRDELIAWIDGSPESSDSPYDNTDFSAAAPGEASQALPAGSKNSPIEQYCSDLSARARAGEIDIVT
GREQEIRTIIDILLRRRQNNPLLTGEAGVGKTAVVEGLALAIANGDVPPALADVRLMTLDVGALLAGASM
KGEFESRLKGVLEAALRSKTPIILFVDEIHTLVGAGGQAGTGDAANLLKPALARGAVRMIGATTWSEYKR
HIEKDPALTRRFQVLQVPEPQEAAAIDMVRGLADTFSKHHGVIVRDEAIRAAVTLSHRYIPSRQLPDKAI
SLLDTACARVALSQHAPPRELQSVRQRLQAARVECGLLEQEARIGLHAEEALSAARARIGTLSTEESAID
AHWRAQLAAAQALASARDAILTQPAPDQADVVPSLATLGQLEHSLLDLQGETPLVFPEVDETVIAEIVSD
WTGIPVGRMVTNEVAAVRALPETLAARVIGQSDPLRQIGERVQTARAGLTDPRKPLGVFLLAGPSGVGKT
ETALALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYAVVLLDEIEKA
HHDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGSELTASLCADATLAPDQDALREALNPELLKV
FPAAFLGRVTVVPYRPLVHASLASIVRLHMNRVVQRMADSHGIALHYNEQVIDYIVSRCLVQETGARVLI
GFIEQHVLPRLSALWLDAFSSKRVLSSIEIQIGDSNVTPAAAFVFASANKPAFSESISPVSVGETH
 
Nucleotide Sequence: 2721 bp     [Download]
>gi|187922035|ref|NC_010681.1|:c1061778-1059058 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGACGATTTCCCGCCAGGCACTCTTTGGCAAGCTCGGGGCCACACTCTTCCGCAGCATCGAATCCGCTA
CCGCGTTTTGCAAGCTGCGCGGCAACCCGTATGTGGAGCTTGTCCATTGGCTGCATCAATTGCTGCAATT
ACCGGACAGCGACATGCACCGCATTGCCCGGCATGCGGGAATCGAACGTACAACACTGGAACGCGATCTC
GCACGGGCGCTCGCCGCCTTGCCCGCAGGCGCCAGTTCGATCAGCGACATCTCGCACCATATTGAACTGG
CCGTCGAGCGAGCATGGGTGCTTGCCACGCTCGATTTCGGCGACCGCCGGATACGCGGCGCGTGGTTGCT
TGCAGCATTGCTTGGCACGCCGGAACTGCGTCGGGTACTGCTTTCGGCTTCGCCCGCATTCGCTCGCATC
CCGGTCGATACGCCACGCGACGAACTGATTGCGTGGATCGACGGCTCGCCCGAATCTTCCGACTCGCCGT
ACGACAACACGGACTTCTCCGCCGCAGCGCCGGGCGAGGCTTCGCAGGCACTGCCCGCAGGTTCGAAGAA
CTCGCCAATCGAGCAGTACTGCAGCGACCTGAGCGCGCGAGCCCGCGCAGGTGAAATCGACATCGTGACG
GGACGCGAGCAGGAGATTCGCACGATCATCGATATCCTGCTGCGCCGCCGTCAAAACAACCCGCTGCTCA
CTGGCGAGGCCGGCGTCGGCAAGACCGCTGTCGTAGAAGGGCTCGCACTTGCCATCGCTAACGGCGACGT
GCCGCCCGCGCTGGCCGACGTGCGGCTCATGACGCTCGACGTCGGCGCATTGCTGGCTGGTGCGAGTATG
AAAGGGGAATTCGAGTCGCGGCTCAAAGGCGTGCTCGAAGCCGCGTTACGGTCCAAGACACCCATCATTC
TGTTCGTCGACGAAATCCACACGCTCGTCGGCGCGGGCGGTCAGGCCGGCACCGGCGACGCCGCCAATCT
TCTCAAGCCGGCCCTCGCGCGAGGCGCGGTGCGCATGATCGGAGCGACGACCTGGTCGGAGTACAAGCGG
CACATCGAAAAAGATCCCGCTCTCACCCGGCGCTTTCAGGTACTGCAGGTCCCCGAACCGCAGGAAGCCG
CAGCCATCGACATGGTGCGGGGACTGGCCGACACGTTTTCGAAGCACCACGGCGTGATTGTCCGAGACGA
AGCGATCCGCGCCGCCGTTACGTTGTCCCATCGCTATATTCCTTCGCGGCAGTTGCCCGACAAGGCGATC
AGTCTGCTCGACACCGCATGCGCACGCGTGGCGCTCTCGCAGCATGCGCCGCCGCGCGAACTGCAAAGCG
TGCGTCAACGACTTCAGGCGGCGCGCGTCGAGTGTGGCCTGCTTGAACAGGAGGCGCGTATCGGACTCCA
TGCGGAGGAGGCGCTGAGTGCCGCCAGGGCGCGCATCGGTACGCTCTCCACGGAGGAAAGCGCAATCGAC
GCACATTGGCGCGCCCAGCTCGCAGCCGCACAGGCGTTAGCGAGCGCCCGCGACGCCATCCTTACCCAGC
CCGCCCCGGATCAAGCCGATGTTGTGCCATCCCTCGCGACACTCGGCCAGCTGGAGCACAGCCTCCTTGA
CCTTCAGGGTGAGACGCCACTCGTTTTCCCGGAAGTAGACGAAACGGTCATCGCGGAAATCGTCTCGGAC
TGGACCGGCATTCCCGTCGGTCGCATGGTAACGAATGAAGTTGCGGCTGTGCGCGCCTTGCCCGAAACAC
TCGCCGCCCGCGTGATCGGGCAAAGTGATCCCTTGCGCCAGATCGGTGAGCGAGTGCAGACGGCGCGCGC
GGGTCTTACCGATCCCCGCAAACCACTCGGCGTGTTTCTGCTGGCGGGGCCGTCCGGCGTCGGCAAGACG
GAAACGGCGCTCGCACTGGCCGAAGCTCTGTATGGCGGCGAGCAGAACCTGATCACGATCAACATGAGCG
AGTATCAGGAGGCGCACACGGTCTCCGGACTCAAGGGCGCACCGCCCGGATACGTCGGTTACGGTGAAGG
CGGCGTGCTGACAGAAGCCGTCCGCCGGCGCCCGTATGCAGTTGTTCTGCTCGACGAGATCGAAAAGGCG
CATCACGACGTACATGAAATGTTCTTCCAGGTGTTCGACAAGGGCTACATGGAAGACGGCGACGGACGCT
ACATCGACTTCCGCAATACCACGATCCTTTTGACCAGCAATGCCGGGTCCGAGCTGACAGCGAGCCTATG
CGCGGACGCCACACTCGCACCCGATCAGGACGCCCTACGTGAAGCGTTAAACCCTGAGTTGCTCAAAGTA
TTTCCCGCGGCCTTTCTCGGACGCGTGACCGTCGTGCCGTATCGCCCGCTGGTTCACGCGTCGCTCGCCA
GCATCGTGCGTCTGCATATGAACCGTGTCGTGCAGCGCATGGCGGACAGTCATGGTATTGCACTGCATTA
CAACGAACAGGTAATCGACTACATCGTCAGCCGCTGCCTCGTGCAGGAGACCGGCGCCCGGGTGTTGATC
GGGTTTATCGAGCAACACGTTCTGCCGAGACTGTCTGCTCTCTGGCTCGACGCTTTCTCGTCGAAGCGAG
TCCTCTCGAGCATCGAAATCCAGATCGGCGACAGCAACGTCACGCCTGCTGCCGCATTCGTCTTTGCATC
TGCCAACAAGCCAGCGTTCAGCGAGAGCATTTCCCCGGTTTCAGTCGGCGAGACTCATTAA