SecReT6
Protein ID: 187922945
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0944
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1063077..1063949 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDB2T106
KEGG IDbpy:Bphyt_0944
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.10E-46, Aligned region: 14..29
ImpE [PF07024], Evalue: 6.10E-46, Aligned region: 146..271
Protein Sequence: 290 a.a.     [Download]
>gi|187922945|ref|YP_001894587.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MTAQPLPNVFASQQRQWSPAAQIEMVEANIRSQPTLAAHRWTLFQWLCITYQWTRAIQQLQGFAQLEPSQ
ASVAQACRDLVRAEHWRAKVMAGQQEPGWVFGDAPAWIHGMLSALKLSAQGQQDASDDARERALHLAPLV
AGHTSNQRFEWIGDSDSRLGPVCELITAGRYRWLSLADIASWRIERPSTLLDLVWAPCTLSLIDGAVLRG
FMPARYPLAAHGSPVLRETLQLGHETVWHESGRTAVMASGRKTWTTSAADFDLFELADCSFGPAAVDGTA
HSGAAAGVQQ
 
Nucleotide Sequence: 873 bp     [Download]
>gi|187922035|ref|NC_010681.1|:1063077-1063949 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGACCGCCCAACCGCTACCGAATGTCTTCGCGAGCCAGCAACGCCAGTGGTCGCCGGCAGCACAGATCG
AAATGGTCGAAGCGAACATTCGTAGTCAACCGACGTTGGCCGCGCATCGCTGGACGCTGTTCCAGTGGCT
ATGTATCACGTACCAGTGGACGCGGGCCATCCAGCAACTTCAGGGTTTTGCCCAACTGGAGCCGTCCCAG
GCATCCGTCGCGCAAGCCTGCCGAGACCTGGTTCGCGCGGAACACTGGCGCGCAAAAGTCATGGCCGGGC
AGCAGGAGCCGGGGTGGGTATTCGGCGACGCGCCCGCGTGGATACACGGCATGCTCAGTGCGCTCAAACT
GTCCGCGCAGGGACAACAGGACGCGTCGGACGACGCCCGGGAGCGCGCGTTGCATCTCGCTCCGCTGGTC
GCCGGGCACACCTCGAATCAGCGCTTTGAATGGATCGGTGACAGCGATTCGCGGCTAGGCCCGGTCTGTG
AGCTAATTACCGCCGGGCGGTATCGCTGGCTTTCGCTGGCGGATATCGCCAGTTGGCGGATCGAAAGGCC
GTCGACGCTACTCGACCTCGTGTGGGCGCCGTGCACGCTGTCGCTGATCGACGGCGCGGTGCTGCGCGGC
TTCATGCCGGCACGTTATCCGCTCGCCGCCCACGGGTCACCTGTCCTGCGCGAGACGCTGCAACTCGGGC
ATGAGACCGTTTGGCATGAGTCGGGGCGCACGGCCGTCATGGCATCCGGGCGCAAGACCTGGACGACAAG
CGCGGCTGATTTCGATCTGTTCGAATTGGCTGACTGTTCGTTTGGTCCCGCCGCGGTGGACGGCACCGCG
CACTCCGGTGCGGCGGCAGGAGTGCAGCAATGA