SecReT6
Protein ID: 187922946
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0945
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1063946..1064482 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB2T107
KEGG IDbpy:Bphyt_0945
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.70E-20, Aligned region: 47..159
Protein Sequence: 178 a.a.     [Download]
>gi|187922946|ref|YP_001894588.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MSRKRHEPDRTAPAPRQADAQLLPTLFDRLRDDAPHRQTESPGDYAVSRAQMRDIIQRDLAFLLNATSME
DLIDRKRHSYAAASTINFGVPPLAGAFMASHKWAKIEEVIRGAIRDFEPRLIAHTVQVVPLTDVDSQSRY
NHLAFEIRGMIHMDPYPLEFMVQSSLDLETSRLHAAAR
 
Nucleotide Sequence: 537 bp     [Download]
>gi|187922035|ref|NC_010681.1|:1063946-1064482 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGAGCCGCAAACGTCATGAACCGGACCGAACGGCGCCTGCGCCGCGCCAGGCCGATGCACAGCTGCTGC
CCACCTTATTCGATCGGCTGCGCGACGACGCACCGCACCGGCAGACCGAGTCGCCCGGCGACTATGCGGT
CAGCCGGGCGCAGATGCGCGACATCATCCAGCGCGATCTTGCGTTTCTGCTCAACGCGACCAGCATGGAA
GACCTGATCGATCGGAAGCGGCATTCATACGCGGCCGCATCGACCATCAACTTTGGCGTGCCGCCGCTCG
CAGGGGCGTTCATGGCGTCGCACAAATGGGCAAAGATCGAGGAGGTGATACGGGGCGCCATACGCGACTT
CGAGCCGCGGCTGATTGCACATACGGTGCAGGTCGTGCCCCTCACGGATGTCGATAGCCAGAGTCGCTAC
AACCACCTCGCGTTCGAGATCCGCGGAATGATCCACATGGACCCCTATCCGCTCGAGTTCATGGTGCAAA
GCTCGCTCGACCTTGAAACAAGCCGCCTGCACGCAGCGGCTCGTTGA