SecReT6
Protein ID: 187922947
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0946
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1064498..1066387 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB2T108
KEGG IDbpy:Bphyt_0946
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-213, Aligned region: 5..628
Protein Sequence: 629 a.a.     [Download]
>gi|187922947|ref|YP_001894589.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MDPRLLDYYNQELMYVRELAGEFAQLHPKIARRLGMQAGEMTDPYVERLIESFSFMAARMQLKLDAEFPR
FTGRLLEVIYPNYVAPTPSMAVARFYPSPSEGNLVEGFPVRRGSMLTGKKSPGENTLCEFRTGQDVALYP
LEITHAQLTGIPPDIPMLDRYVPPHTQVRGALRLRLRSTGDAKIAELRGLDRLPVYLAGDEQVASHLFEL
LHAAGVASITGEPGRFGDAARPFCAVTHGAVAHEGLGVDQGLLPLTWSKFHGHNLLHEYFACPSRFYFFT
LTGLREGLSKAKGHEVEIVVLLDQSPDRLIGLVDASRFALFCTPVINLFPRKAQRIELNQASTEFHLVPK
RSAPLDYEVYSVEALTAQVGKNSTEFAFRPLYQTLNNDEGNHGRYFSLRRERRLLSDSARRYGTRTPYIG
TEVFVSLVDQQEAPYHEGMRYLSIDAWLTNRDLPNLLPRNGVDDLDAVDSVPAISVGLIRAPSAPRAPFA
ERETAWRLIRQLNFNYLPLEDMDHRPGGQGVRDMLRLFLTGDDVGPRRQVESLVGVKTRPVARKLPGGGP
LVFGRGIECQLTVDETGFSGLSPYLFGVILEHYLARHVSINSFTQTELHSMQRGQLMRWPVRMGTRGVA
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|187922035|ref|NC_010681.1|:1064498-1066387 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGGATCCGCGACTGCTCGATTACTACAACCAGGAACTGATGTATGTACGCGAACTGGCTGGCGAGTTCG
CGCAACTGCATCCGAAGATCGCGCGGCGGCTCGGCATGCAGGCCGGCGAGATGACCGATCCGTACGTCGA
ACGGCTGATCGAGTCGTTCAGCTTCATGGCGGCGCGTATGCAGCTCAAGCTCGACGCGGAATTCCCGCGC
TTCACGGGACGTCTGCTAGAGGTGATCTACCCGAACTATGTGGCACCGACGCCGTCCATGGCGGTCGCGC
GCTTCTATCCGAGCCCGAGCGAAGGCAACCTCGTCGAAGGCTTCCCTGTGCGGCGCGGCAGCATGCTCAC
GGGCAAGAAGTCGCCGGGGGAGAACACTTTGTGCGAATTCCGCACGGGCCAGGACGTCGCGCTCTATCCG
CTCGAGATTACCCATGCACAACTGACGGGGATTCCGCCGGACATTCCCATGCTCGACCGCTATGTGCCGC
CCCACACGCAAGTGCGTGGCGCATTGCGGCTGCGATTGCGTTCCACGGGCGATGCCAAAATCGCCGAGCT
GCGCGGACTCGACCGACTGCCGGTCTATCTCGCCGGAGATGAGCAGGTTGCGTCGCATCTGTTCGAACTG
CTTCACGCGGCAGGCGTTGCGTCGATCACGGGCGAGCCTGGGCGTTTCGGCGACGCGGCGCGCCCCTTCT
GTGCGGTCACGCATGGCGCGGTCGCACACGAGGGGCTTGGCGTCGATCAGGGTTTGCTGCCGCTCACCTG
GTCGAAATTCCATGGGCACAATCTTCTACACGAATATTTCGCATGTCCGAGCCGCTTTTATTTTTTCACG
CTGACCGGACTGCGCGAAGGGCTCAGCAAGGCGAAAGGCCATGAAGTCGAGATCGTGGTGCTGCTCGATC
AGTCACCGGACCGGCTGATCGGCCTTGTCGACGCCTCGCGTTTCGCGCTGTTTTGCACACCCGTGATCAA
TCTGTTTCCGCGCAAAGCGCAGCGCATCGAATTGAATCAGGCCAGCACGGAATTCCATCTGGTTCCGAAG
CGCAGCGCGCCGCTCGACTACGAAGTCTATTCGGTCGAAGCACTCACGGCGCAGGTCGGCAAGAACTCGA
CGGAATTCGCCTTCCGGCCGTTGTATCAAACGCTGAACAACGACGAAGGCAACCACGGGCGCTATTTTTC
GCTTCGCCGCGAACGCCGGTTGTTATCTGACTCGGCCCGCCGCTACGGTACGCGCACGCCGTACATTGGA
ACTGAAGTGTTCGTGTCGCTGGTCGACCAGCAGGAAGCGCCGTATCACGAGGGAATGCGCTATCTGTCGA
TCGACGCCTGGCTGACCAATCGCGACTTGCCGAATCTGTTGCCGCGCAACGGCGTGGACGATCTGGACGC
CGTTGACTCGGTGCCTGCGATCAGCGTCGGCTTGATTCGTGCGCCAAGCGCGCCTCGCGCGCCGTTTGCC
GAGCGCGAAACAGCTTGGCGGCTTATCCGGCAACTGAACTTCAACTATTTGCCGCTGGAAGATATGGATC
ACCGCCCTGGCGGCCAGGGTGTGCGCGACATGCTGCGCCTGTTCCTGACCGGCGACGACGTGGGACCGCG
GCGTCAGGTGGAAAGCCTCGTCGGCGTGAAGACGCGGCCGGTCGCGAGGAAGCTGCCCGGTGGCGGCCCG
CTGGTGTTCGGTCGCGGCATCGAATGTCAGTTGACGGTCGATGAAACCGGCTTTTCCGGTTTGAGCCCCT
ACCTGTTCGGGGTGATTCTCGAGCACTATCTGGCACGGCACGTATCTATCAATTCGTTCACGCAGACCGA
GCTTCATTCAATGCAGCGCGGCCAGTTGATGCGCTGGCCCGTGCGCATGGGCACACGTGGAGTGGCTTGA