SecReT6
Protein ID: 187922948
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0947
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1066387..1067499 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB2T109
KEGG IDbpy:Bphyt_0947
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-101, Aligned region: 25..327
Protein Sequence: 370 a.a.     [Download]
>gi|187922948|ref|YP_001894590.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MDRASFTSTLRDTTLSADAVERLQTQPWQFGFFSLMRRIGADVRIDAIGKARRPRAEPFRLGQKPSLAFA
PREIASVGELGGRLHIRLLALGMLGPNGPLPIHMTEIAREREESRRDPTLVHFLDIFHHRYLTLLYRAWA
DAQATAGLDRAGPDSERFSFYVASLTGQDTREIGQRALPAHAQLAASANLVREARNPDGLRMTLEQYFGV
PVAIEEFVFNWIDVAADDHSYIGKPGAAATMGDGAMLGEQVPDRQHRFRIIIGPVDIDEYLRFTPRGADL
PQLVDWVRSFIGREFEWELELRIRAQSAPPAVMGGPQQLGWSGWLGRSPSGEPITGMRFEPERYASTFAK
QSIDAAGKRRVTPQVKGQDE
 
Nucleotide Sequence: 1113 bp     [Download]
>gi|187922035|ref|NC_010681.1|:1066387-1067499 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGGACCGCGCCTCATTTACGTCGACGCTGCGCGACACGACGCTATCGGCGGATGCAGTCGAGCGGCTGC
AGACGCAGCCGTGGCAATTCGGATTTTTCTCGCTGATGCGCCGCATCGGCGCCGATGTGCGTATCGATGC
GATCGGCAAGGCGCGGCGTCCGCGTGCGGAGCCATTCCGGCTAGGTCAGAAGCCGAGCCTTGCATTCGCG
CCGCGTGAGATCGCCAGTGTGGGCGAACTCGGCGGGCGCCTGCATATTCGTCTGTTAGCACTCGGCATGC
TTGGGCCGAATGGGCCGCTGCCCATCCACATGACGGAGATTGCCAGGGAGCGTGAAGAAAGCCGGCGCGA
TCCTACGCTGGTTCATTTCCTCGATATTTTTCACCATCGCTACCTCACGCTGTTGTACCGCGCATGGGCC
GACGCACAGGCGACCGCTGGACTCGACCGTGCCGGGCCCGATAGCGAACGATTCTCCTTCTATGTCGCGA
GCCTGACCGGCCAGGATACGCGCGAGATTGGGCAGCGCGCTCTGCCCGCACACGCGCAACTTGCCGCGTC
TGCGAATCTCGTGCGTGAAGCCCGCAACCCGGATGGCTTGCGCATGACGCTCGAGCAGTATTTCGGGGTT
CCCGTCGCGATCGAGGAGTTCGTTTTTAACTGGATCGACGTTGCTGCCGACGATCACAGCTATATCGGCA
AGCCCGGCGCCGCGGCGACGATGGGCGACGGCGCGATGCTCGGGGAGCAGGTGCCCGATCGTCAGCACCG
TTTCCGGATCATCATCGGGCCGGTCGATATCGACGAATATCTGCGCTTCACGCCTCGCGGCGCGGATCTG
CCGCAACTGGTCGATTGGGTACGGAGTTTCATCGGTCGCGAATTCGAATGGGAGCTGGAGTTGCGCATCC
GCGCACAAAGCGCGCCGCCTGCCGTGATGGGCGGCCCGCAGCAATTGGGCTGGTCGGGGTGGCTCGGTCG
CTCGCCCAGCGGCGAGCCGATTACCGGCATGCGCTTCGAGCCTGAACGCTACGCCAGCACGTTCGCGAAA
CAAAGTATCGACGCGGCGGGCAAGCGCCGGGTCACGCCGCAAGTGAAGGGACAAGATGAGTAG